DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tie and CSF1R

DIOPT Version :9

Sequence 1:NP_523928.1 Gene:Tie / 38559 FlyBaseID:FBgn0014073 Length:1233 Species:Drosophila melanogaster
Sequence 2:NP_001275634.1 Gene:CSF1R / 1436 HGNCID:2433 Length:972 Species:Homo sapiens


Alignment Length:437 Identity:123/437 - (28%)
Similarity:181/437 - (41%) Gaps:133/437 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   838 DKTSLA-SEFHDFERSNIRLKSLLGEGNFGQVWKAEADDLSGHFGATRIVAVKTIRA---CSAQV 898
            |.|.|. :|..:|.|:|::....||.|.||:|.:|.|..| |...|...||||.:::   ...:.
Human   565 DPTQLPYNEKWEFPRNNLQFGKTLGAGAFGKVVEATAFGL-GKEDAVLKVAVKMLKSTAHADEKE 628

  Fly   899 SLKDEANIMRKLGSHQNVVTLLGACVESEPHMLIMEYAMRGRLLSLLRAARSATNIL-PASVPG- 961
            :|..|..||..||.|:|:|.|||||....|.::|.||...|.||:.||  |.|..:| |:..|| 
Human   629 ALMSELKIMSHLGQHENIVNLLGACTHGGPVLVITEYCCYGDLLNFLR--RKAEAMLGPSLSPGQ 691

  Fly   962 -------------------------------------------------------GRSLAPLSPR 971
                                                                   ||   ||..|
Human   692 DPEGGVDYKNIHLEKKYVRRDSGFSSQGVDTYVEMRPVSTSSNDSFSEQDLDKEDGR---PLELR 753

  Fly   972 TLAGFALDIACGMEYIAGRRIVHRDLAARNVLLDHNGMCKICDFGMSIDLDAERMRKEQEKNAAN 1036
            .|..|:..:|.||.::|.:..:|||:|||||||.:..:.||.|||::.|:          .|.:|
Human   754 DLLHFSSQVAQGMAFLASKNCIHRDVAARNVLLTNGHVAKIGDFGLARDI----------MNDSN 808

  Fly  1037 DLMRHNAHKFKFDFGSRYILQHWQHTFGQGQGQGHCSKDQPHGEKKSHHGHDTIGKRHALPIRWM 1101
            .:::.||.                                                   ||::||
Human   809 YIVKGNAR---------------------------------------------------LPVKWM 822

  Fly  1102 APESLQYHMFTTETDIWAFGIVLWEIATLGSTPY-SQLTGREVIRRVPQGLRPDLPKESRHEFYN 1165
            ||||:...::|.::|:|::||:||||.:||..|| ..|...:..:.|..|.:...|..:....|:
Human   823 APESIFDCVYTVQSDVWSYGILLWEIFSLGLNPYPGILVNSKFYKLVKDGYQMAQPAFAPKNIYS 887

  Fly  1166 LMSRCWHKEPHMRPSFAQSRLEITRSLHKWVDDDSAASDYMDVSGFS 1212
            :|..||..||..||:|.|    |...|.:...:|....||.::...|
Human   888 IMQACWALEPTHRPTFQQ----ICSFLQEQAQEDRRERDYTNLPSSS 930

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TieNP_523928.1 TyrKc 854..1183 CDD:197581 109/389 (28%)
PTKc 860..1187 CDD:270623 110/387 (28%)
CSF1RNP_001275634.1 IG_like 28..85 CDD:214653
ig 207..293 CDD:365836
Ig4_SCFR_like 299..400 CDD:319281
Ig 416..495 CDD:319273
Regulatory juxtamembrane domain 542..574 3/8 (38%)
PTKc_CSF-1R 543..914 CDD:133237 119/419 (28%)
Activation loop 796..818 8/82 (10%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 918..950 3/13 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.