DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tie and Frk

DIOPT Version :9

Sequence 1:NP_523928.1 Gene:Tie / 38559 FlyBaseID:FBgn0014073 Length:1233 Species:Drosophila melanogaster
Sequence 2:NP_001153016.1 Gene:Frk / 14302 MGIID:103265 Length:512 Species:Mus musculus


Alignment Length:367 Identity:106/367 - (28%)
Similarity:161/367 - (43%) Gaps:94/367 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   848 DFERSNIRLKSLLGEGNFGQVWKAEADDLSGHFGATRIVAVKTIRACSAQVS-LKDEANIMRKLG 911
            :.:|::|:|...||.|.||:||:       |.:..|..|||||::..|...: ...||.||:.| 
Mouse   235 EIDRNSIQLLKRLGSGQFGEVWE-------GLWNNTTPVAVKTLKPGSMDPNDFLREAQIMKSL- 291

  Fly   912 SHQNVVTLLGACVESEPHMLIMEYAMRGRLLSLLRAARSATNILPASVPGGRSLAPLSPRTLAGF 976
            .|..::.|...|...:|..:|.|....|.|...|:.            .||..:..:..   ...
Mouse   292 RHPKLIQLYAVCTLEDPIYIITELMRHGSLQEYLQN------------DGGSKIHLIQQ---VDM 341

  Fly   977 ALDIACGMEYIAGRRIVHRDLAARNVLLDHNGMCKICDFGMSIDLDAERMRKEQEKNAANDLMRH 1041
            |..:|.||.|:..:..:||||||||||:..:.:.|:.|||:                        
Mouse   342 AAQVASGMAYLESQNYIHRDLAARNVLVGEHNIYKVADFGL------------------------ 382

  Fly  1042 NAHKFKFDFGSRYILQHWQHTFGQGQGQGHCSKDQPHGEKKSHHGHDTIGKRHALPIRWMAPESL 1106
             |..||.|....|..:|                     |.|             ||::|.|||::
Mouse   383 -ARVFKVDNEDIYESKH---------------------EIK-------------LPVKWTAPEAI 412

  Fly  1107 QYHMFTTETDIWAFGIVLWEIATLGSTPYSQLTGREVIRRVPQGLRPDLPKESRHEFYNLMSRCW 1171
            :.:.|:.::|:|:|||:|:||.|.|..|||.:||.:||:.:.|..|...|.....:||::|..||
Mouse   413 RTNKFSIKSDVWSFGILLYEIITYGKMPYSGMTGAQVIQMLSQNYRLPQPSNCPQQFYSIMLECW 477

  Fly  1172 HKEPHMRPSFAQSRLEITRSLHKWVDDDSAASD--YMDVSGF 1211
            :.||..||:|        .:|| |..:|...:|  |.|.:.|
Mouse   478 NVEPKQRPTF--------ETLH-WKLEDYFETDCSYSDTNNF 510

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TieNP_523928.1 TyrKc 854..1183 CDD:197581 97/329 (29%)
PTKc 860..1187 CDD:270623 95/327 (29%)
FrkNP_001153016.1 SH3_Src_like 54..111 CDD:212779
SH2_Src_Frk 119..214 CDD:199831
PTKc_Frk_like 232..501 CDD:270653 102/356 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D539311at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.