DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tie and Flt3

DIOPT Version :9

Sequence 1:NP_523928.1 Gene:Tie / 38559 FlyBaseID:FBgn0014073 Length:1233 Species:Drosophila melanogaster
Sequence 2:NP_034359.2 Gene:Flt3 / 14255 MGIID:95559 Length:1000 Species:Mus musculus


Alignment Length:456 Identity:123/456 - (26%)
Similarity:184/456 - (40%) Gaps:148/456 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   845 EFHDFE--------RSNIRLKSLLGEGNFGQVWKAEADDLSGHFGATRIVAVKTIR----ACSAQ 897
            :|.|:|        |.|:....:||.|.||:|..|.|..:| ..|.:..||||.::    :|..:
Mouse   594 DFRDYEYDLKWEFPRENLEFGKVLGSGAFGRVMNATAYGIS-KTGVSIQVAVKMLKEKADSCEKE 657

  Fly   898 VSLKDEANIMRKLGSHQNVVTLLGACVESEPHMLIMEYAMRGRLLSLLRAARSA-----TNILP- 956
             :|..|..:|..||.|.|:|.|||||..|.|..||.||...|.||:.||:.|..     |.|.. 
Mouse   658 -ALMSELKMMTHLGHHDNIVNLLGACTLSGPVYLIFEYCCYGDLLNYLRSKREKFHRTWTEIFKE 721

  Fly   957 --------------ASVPGGR---------------------------------------SLAPL 968
                          :|:||.|                                       .|..|
Mouse   722 HNFSFYPTFQAHSNSSMPGSREVQLHPPLDQLSGFNGNLIHSEDEIEYENQKRLAEEEEEDLNVL 786

  Fly   969 SPRTLAGFALDIACGMEYIAGRRIVHRDLAARNVLLDHNGMCKICDFGMSIDLDAERMRKEQEKN 1033
            :...|..||..:|.|||::..:..|||||||||||:.|..:.||||||::.|:.::         
Mouse   787 TFEDLLCFAYQVAKGMEFLEFKSCVHRDLAARNVLVTHGKVVKICDFGLARDILSD--------- 842

  Fly  1034 AANDLMRHNAHKFKFDFGSRYILQHWQHTFGQGQGQGHCSKDQPHGEKKSHHGHDTIGKRHALPI 1098
             ::.::|.||.                                                   ||:
Mouse   843 -SSYVVRGNAR---------------------------------------------------LPV 855

  Fly  1099 RWMAPESLQYHMFTTETDIWAFGIVLWEIATLGSTPYSQL-TGREVIRRVPQGLRPDLPKESRHE 1162
            :|||||||...::|.::|:|::||:||||.:||..||..: ......:.:..|.:.:.|..:...
Mouse   856 KWMAPESLFEGIYTIKSDVWSYGILLWEIFSLGVNPYPGIPVDANFYKLIQSGFKMEQPFYATEG 920

  Fly  1163 FYNLMSRCWHKEPHMRPSFAQSRLEITRSLHKWVDDDSAASD---YMDVSGFSEDLEHGVVYFNH 1224
            .|.:|..||..:...||||.        :|..::....|.::   |.::.|  ...||..:|.|.
Mouse   921 IYFVMQSCWAFDSRKRPSFP--------NLTSFLGCQLAEAEEAMYQNMGG--NVPEHPSIYQNR 975

  Fly  1225 R 1225
            |
Mouse   976 R 976

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TieNP_523928.1 TyrKc 854..1183 CDD:197581 109/392 (28%)
PTKc 860..1187 CDD:270623 109/390 (28%)
Flt3NP_034359.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 45..67
ig 256..346 CDD:278476
PKc_like 573..950 CDD:304357 115/426 (27%)
Important for normal regulation of the kinase activity and for maintaining the kinase in an inactive state in the absence of ligand binding. /evidence=ECO:0000250 592..598 1/3 (33%)
Pkinase_Tyr 611..946 CDD:285015 110/405 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 968..1000 4/9 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24416
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.