DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tie and LOC100491469

DIOPT Version :9

Sequence 1:NP_523928.1 Gene:Tie / 38559 FlyBaseID:FBgn0014073 Length:1233 Species:Drosophila melanogaster
Sequence 2:XP_031750439.1 Gene:LOC100491469 / 100491469 -ID:- Length:489 Species:Xenopus tropicalis


Alignment Length:289 Identity:84/289 - (29%)
Similarity:123/289 - (42%) Gaps:92/289 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   851 RSNIRLKSLLGEGNFGQVWKAEADDLSGHFGATRIVAVKTIRACSAQVS-LKDEANIMRKLGSHQ 914
            ||..:|...||.||||:||:       |.:.....||:||.:..:...| .|.|.|.::.| .|:
 Frog   220 RSEFKLVRQLGAGNFGEVWE-------GLWNNKDKVAIKTFKQDNINESDFKKEVNALKTL-CHK 276

  Fly   915 NVVTLLGACVESEPHMLIMEYAMRGRLLSLLRAARSATNILPASVPGGRSLAPLSPRTLAGF--- 976
            |::.|...|...||..::.|...:|.||..||...            ||.|      |...|   
 Frog   277 NLIQLYAVCSVGEPVYIVTELMSKGSLLQFLRGTE------------GRHL------TAGSFMHI 323

  Fly   977 ALDIACGMEYIAGRRIVHRDLAARNVLLDHNGMCKICDFGMSIDLDAERMRKEQEKNAANDLMRH 1041
            ...:|.||.::....:|||||||||||:....:||:.|||::      |:.|:       ||   
 Frog   324 ISQVAEGMVFLEKEHVVHRDLAARNVLVGEKLVCKVADFGLA------RILKD-------DL--- 372

  Fly  1042 NAHKFKFDFGSRYILQHWQHTFGQGQGQGHCSKDQPHGEKKSHHGHDTIGKRHALPIRWMAPESL 1106
                        |.||                     |..|             :||:|.|||.|
 Frog   373 ------------YSLQ---------------------GNIK-------------IPIKWTAPEVL 391

  Fly  1107 QYHMFTTETDIWAFGIVLWEIATLGSTPY 1135
            ...:::|::|:|::|||::|:..||..||
 Frog   392 TRSIYSTKSDVWSYGIVMYEVYMLGQMPY 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TieNP_523928.1 TyrKc 854..1183 CDD:197581 82/286 (29%)
PTKc 860..1187 CDD:270623 81/280 (29%)
LOC100491469XP_031750439.1 SH3_Srms 46..100 CDD:212780
SH2 113..191 CDD:417686
PKc_like 216..>422 CDD:419665 84/289 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D539311at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.