DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tie and ptk6

DIOPT Version :9

Sequence 1:NP_523928.1 Gene:Tie / 38559 FlyBaseID:FBgn0014073 Length:1233 Species:Drosophila melanogaster
Sequence 2:XP_002942429.3 Gene:ptk6 / 100490792 XenbaseID:XB-GENE-22069031 Length:563 Species:Xenopus tropicalis


Alignment Length:342 Identity:102/342 - (29%)
Similarity:147/342 - (42%) Gaps:99/342 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   851 RSNIRLKSLLGEGNFGQV----WKAEADDLSGHFGATRIVAVKTIR--ACSAQVSLKDEANIMRK 909
            |....|...||.||||||    ||.:..           ||||||:  |.|..:.:|:.|.:  |
 Frog   284 REEFTLVKRLGMGNFGQVHEGLWKGKLK-----------VAVKTIKRDATSQDLFVKETAFL--K 335

  Fly   910 LGSHQNVVTLLGACVESEPHMLIMEYAMRGRLLSLLRAARSATNILPASVPGGRSLAPLSPRTLA 974
            ...|:|:::|...|...:|:.::.|...||.||:.||.....    ...|.|...:         
 Frog   336 TLHHKNLLSLYAVCSVGDPYYIVTELVPRGDLLNYLRDLEKD----ELDVEGQLDI--------- 387

  Fly   975 GFALDIACGMEYIAGRRIVHRDLAARNVLLDHNGMCKICDFGMS-IDLDAERMRKEQEKNAANDL 1038
              |..:|.||.|:..:..:||||||||||:..|.:|||.||||: :.||                
 Frog   388 --ATQVAEGMRYLESQNCIHRDLAARNVLMGRNNICKIADFGMARVILD---------------- 434

  Fly  1039 MRHNAHKFKFDFGSRYILQHWQHTFGQGQGQGHCSKDQPHGEKKSHHGHDTIGKRHALPIRWMAP 1103
                         |.|:               ..||:                    :|.:|.||
 Frog   435 -------------SYYV---------------SASKE--------------------IPFKWTAP 451

  Fly  1104 ESLQYHMFTTETDIWAFGIVLWEIATLGSTPYSQLTGREVIRRVPQGLRPDLPKESRHEFYNLMS 1168
            |:::|..:|.::|:|:|||:|:||.:||..||..|:..||:..:.:|.|...|.......||:|.
 Frog   452 EAVEYGRYTVKSDVWSFGILLYEIMSLGMQPYPALSNYEVLEFLNRGQRMKAPPSCSTRVYNIML 516

  Fly  1169 RCWHKEPHMRPSFAQSR 1185
            .||...|:.||||...|
 Frog   517 TCWAWNPNERPSFDDLR 533

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TieNP_523928.1 TyrKc 854..1183 CDD:197581 100/335 (30%)
PTKc 860..1187 CDD:270623 100/333 (30%)
ptk6XP_002942429.3 SH3 104..161 CDD:418401
SH2 168..252 CDD:214585
STYKc 288..536 CDD:214568 101/338 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D539311at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.