DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tie and frk

DIOPT Version :9

Sequence 1:NP_523928.1 Gene:Tie / 38559 FlyBaseID:FBgn0014073 Length:1233 Species:Drosophila melanogaster
Sequence 2:XP_002938349.1 Gene:frk / 100488362 XenbaseID:XB-GENE-492884 Length:517 Species:Xenopus tropicalis


Alignment Length:369 Identity:105/369 - (28%)
Similarity:164/369 - (44%) Gaps:99/369 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   848 DFERSNIRLKSLLGEGNFGQVWKAEADDLSGHFGATRIVAVKTIRACSAQVSLKD---EANIMRK 909
            :..|::::....||:|.||:||:       |.:..|..||:||::  :..::.:|   ||..|:.
 Frog   241 EINRNSLKFLKKLGQGQFGEVWE-------GLWNNTIPVAIKTLK--TGTMNPQDFLREAQFMKN 296

  Fly   910 LGSHQNVVTLLGACVESEPHMLIMEYAMRGRLLSLLRAARSATNILPASVPGGRSLAPLSPRTLA 974
            | .|..::.|...|...||..:|.|....|.|||.|:.....:..:|..|               
 Frog   297 L-RHPKLIQLQAVCTLEEPVYIITELMRHGSLLSYLQNDNGTSIHIPNQV--------------- 345

  Fly   975 GFALDIACGMEYIAGRRIVHRDLAARNVLLDHNGMCKICDFGMSIDLDAERMRKEQEKNAANDLM 1039
            ..|..:|.||.|:..:..:||||||||||:..||:.|:.|||:                      
 Frog   346 DMAAQVASGMAYLETQSFIHRDLAARNVLVGENGVYKVADFGL---------------------- 388

  Fly  1040 RHNAHKFKFDFGSRYILQHWQHTFGQGQGQGHCSKDQPHGEKKSHHGHDTIGKRHALPIRWMAPE 1104
               |..||                               ||......:||     .||::|.|||
 Frog   389 ---ARVFK-------------------------------GEDVYEAKNDT-----KLPLKWTAPE 414

  Fly  1105 SLQYHMFTTETDIWAFGIVLWEIATLGSTPYSQLTGREVIRRVPQGLRPDLPKESRHEFYNLMSR 1169
            :::|:.||.::|:|||||:::||.|.|..||..||||:.:.::..|.|...|....|:.|.:|..
 Frog   415 AIRYNRFTIKSDVWAFGILIFEIVTYGKMPYPGLTGRQALDKLENGYRIPKPFNCPHDLYKIMLE 479

  Fly  1170 CWHKEPHMRPSF--AQSRLEITRSLHKWVDDDSAASDYMDVSGF 1211
            ||:.:|..||:|  .|.:||      .:.:.|  .|.|::.:.|
 Frog   480 CWNAKPEERPTFETLQWKLE------DYFETD--PSSYLEANNF 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TieNP_523928.1 TyrKc 854..1183 CDD:197581 97/333 (29%)
PTKc 860..1187 CDD:270623 98/331 (30%)
frkXP_002938349.1 SH3_Src_like 65..117 CDD:212779
SH2 125..220 CDD:387587
PTKc_Frk_like 238..505 CDD:270653 101/355 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D539311at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.