DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NT1 and spz

DIOPT Version :9

Sequence 1:NP_001261417.1 Gene:NT1 / 38558 FlyBaseID:FBgn0261526 Length:1042 Species:Drosophila melanogaster
Sequence 2:NP_524526.1 Gene:spz / 43256 FlyBaseID:FBgn0003495 Length:326 Species:Drosophila melanogaster


Alignment Length:246 Identity:67/246 - (27%)
Similarity:100/246 - (40%) Gaps:51/246 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   362 DERLDLQRNSAE-ETEEPLPSPEELIAGPRYRLGKRPLPGQKSGSPIKRKRVTSSLRGRP-KTAA 424
            |..:.|||...| ::|:|:|        ||:.......|    .|||.:.|...| ..|| :...
  Fly   115 DTFVSLQRTDTEVQSEQPIP--------PRHPSDTFVFP----DSPIAKYRPPQS-PARPLRNDT 166

  Fly   425 SSHKPVVTPPNKKCERFTSNMCIRTDDYPLEQIMGSIRRHKNAMSALLAEFYDKPNNNLEFSDDF 489
            ..|.|..    |...:...|.|...||||  .:.|...:.||.    .|:|         ||:|.
  Fly   167 KEHNPCA----KDESQHLRNFCTNVDDYP--DLSGLTHKLKNN----FAKF---------FSNDL 212

  Fly   490 DDFSLSKKRREDEGSAGG-----MCQSVVRYARPQKAKSASGEWKYIVNTGQHTQTLRLEKCSNP 549
            ....:|.:       .||     :|:|:.:...|:|...|...|:.|||..::.|.:::|:|...
  Fly   213 QPTDVSSR-------VGGSDERFLCRSIRKLVYPKKGLRADDTWQLIVNNDEYKQAIQIEECEGA 270

  Fly   550 VESCSYLA---QTYRSHCSQVYNYHRLLSWDKVRGLHV--DIFKVPTCCSC 595
            .:.|.:.|   |:|...|.|.|....|.|......|.|  :.||:|:||.|
  Fly   271 DQPCDFAANFPQSYNPICKQHYTQQTLASIKSDGELDVVQNSFKIPSCCKC 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NT1NP_001261417.1 Spaetzle 508..595 CDD:292695 28/91 (31%)
spzNP_524526.1 Spaetzle 228..321 CDD:292695 28/92 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23199
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.