DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NT1 and spz5

DIOPT Version :9

Sequence 1:NP_001261417.1 Gene:NT1 / 38558 FlyBaseID:FBgn0261526 Length:1042 Species:Drosophila melanogaster
Sequence 2:NP_647753.1 Gene:spz5 / 38350 FlyBaseID:FBgn0035379 Length:387 Species:Drosophila melanogaster


Alignment Length:314 Identity:74/314 - (23%)
Similarity:113/314 - (35%) Gaps:68/314 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   317 NTTAFQQPSS--QEEEKMASSNGGQSYSEVEDLAFAGLNGTEIPLSADERLDLQRNSAEETEEPL 379
            :|..|..|.|  ...:..|....|.||    ...|.|  ..:.|......|.:...|.|      
  Fly   106 DTPVFYDPKSIFPPRDPAAQDFNGYSY----QTPFGG--NPQRPSGGGNPLFVSNPSTE------ 158

  Fly   380 PSPEELI---AGPRYRLGKRPLPGQKSG--------------------SPIKRKRVTSSLRGRPK 421
             :|..|:   :|..:|.|.| ...|..|                    :.:..||:...|..:.:
  Fly   159 -APTYLLYTSSGGGHRSGHR-YNSQGGGTSSSGGHLYINQSDKSTPYNATLWLKRLVRDLSRKQR 221

  Fly   422 TAASSHKPVVTPPNKKCERFTSNMCIRTDDYPLEQIMGSIRRHKNAMSALLAEFYDKPNNNLEFS 486
            ........||.|.|::.|.      ....|.|.|....|.|.....|..|.....:.||      
  Fly   222 QPDEVQAEVVEPVNEQTEE------AEEQDNPAEDHPQSKRDVSLNMDLLDIVGVEAPN------ 274

  Fly   487 DDFDDFSLSKKRREDEGSAG--GMCQSVVRYARPQKAKSASGEWKYIVNTGQHT--QTLRLEKCS 547
                  .|.|:.|....|.|  .:||:..::..||.|.::.|.|.::||. |:|  |.::.|.|:
  Fly   275 ------PLKKRSRTKRQSPGRSTLCQTTSQFITPQAALNSRGNWMFVVNE-QNTARQMVKAELCA 332

  Fly   548 NPVESCSYLAQT---YRSHCSQVYNYHRLLSWD-KVRGLHVDIFKVPTCCSCQV 597
            :  .:||.|.:.   |.|.|.|.:...||::.. ..:.|:.|.|..|:||.|.:
  Fly   333 S--NTCSNLCELPNGYNSRCEQKFVQKRLIALQGNGQNLYTDTFWFPSCCVCTI 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NT1NP_001261417.1 Spaetzle 508..595 CDD:292695 29/92 (32%)
spz5NP_647753.1 Spaetzle 291..382 CDD:292695 29/93 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23199
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.