DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NT1 and spz6

DIOPT Version :9

Sequence 1:NP_001261417.1 Gene:NT1 / 38558 FlyBaseID:FBgn0261526 Length:1042 Species:Drosophila melanogaster
Sequence 2:NP_611961.1 Gene:spz6 / 37956 FlyBaseID:FBgn0035056 Length:425 Species:Drosophila melanogaster


Alignment Length:428 Identity:82/428 - (19%)
Similarity:128/428 - (29%) Gaps:163/428 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   321 FQQPSSQEEEKMASSNGGQSY-----------------------SEVEDLAFAG----------- 351
            |.||..|...........:.|                       :|.:|:| ||           
  Fly    20 FSQPQQQSPSDYGEEQPPEGYYAFVESPNAVPPKVRPPPYTFVNAECKDVA-AGKKSAVSVHNIC 83

  Fly   352 --LNGTEIPLSADERLDLQRNSAEETEEPLPSPEELIAGPRYRLGKRPLPGQKSGSPIKRKRVTS 414
              ||..:||     :..|.:|...|     |.|.|||.....:...:.||..|:...:  .:||.
  Fly    84 GDLNKGQIP-----KNPLGQNVLGE-----PYPFELIRNQTLKFLSKTLPVLKADDTL--PKVTQ 136

  Fly   415 SLRGRPKTAASSH---KPVVTPPNKKCERFTSNMCIRTDDY-----PLEQIMGSIRRHKNAMSAL 471
            .:|..|.....|:   :|.....:.:..|.... .:.:::|     .|::.....:|.:|.....
  Fly   137 IIRDEPVEQLDSNNIDRPYPAGGSTRVRRSLPE-GVESNEYSYFDPALDEEEQHKQRDRNNQQRR 200

  Fly   472 LAEFYDKPNNNLEFSDDFDDF-----------------SLSKKRREDEG-----SAGGMCQSVVR 514
            .|| ..||.   :|.|....|                 :.:.:|||:.|     .....|.:.|.
  Fly   201 AAE-ERKPR---KFCDGGGVFCTLYRAIQGDTGGAAPATPTAERREEVGPIRYEGPPTPCPAKVE 261

  Fly   515 YARPQKAKSASGEWKYIVN---TGQHTQTLRLEKCSNPVESCSYL-------------------- 556
            ||.|..||:..|.|:|:|.   .|..|||:.:.:|..  ..|.||                    
  Fly   262 YATPVFAKNYQGAWRYVVQIPYEGYFTQTVEVTRCIQ--ARCHYLDGGCLSSPRWVSLLVAEIFY 324

  Fly   557 ---------------------AQTYR----------------------------SHCSQVYNYHR 572
                                 .|.|:                            :||    :.|.
  Fly   325 PNAEDTVPTSSTTTQAPSVQDFQAYQQYLQKRAGVATASDGTSSGAAGPAAQVDAHC----DGHD 385

  Fly   573 LLSWDKVRGLHVDIFKVPTCCSCQVDGYRQQFPPLSSI 610
            .|...:|| |:.|.|.:|..|.|....|..::....|:
  Fly   386 ELGCFQVR-LYYDWFLIPGSCKCWRPDYFAKYVRRKSV 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NT1NP_001261417.1 Spaetzle 508..595 CDD:292695 32/158 (20%)
spz6NP_611961.1 Spaetzle 256..407 CDD:292695 32/157 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23199
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.