DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11350 and LOC3290181

DIOPT Version :10

Sequence 1:NP_647910.1 Gene:CG11350 / 38554 FlyBaseID:FBgn0035552 Length:456 Species:Drosophila melanogaster
Sequence 2:XP_557177.2 Gene:LOC3290181 / 3290181 VectorBaseID:AGAMI1_003104 Length:218 Species:Anopheles gambiae


Alignment Length:240 Identity:85/240 - (35%)
Similarity:99/240 - (41%) Gaps:81/240 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 SQYLPPGRGAASAPVASYSAPSQSYSVEASAPVASYSAPVESSYSVAASAPAVSYAAPAVSYAAP 87
            |:.|....||.....:.|...| ||...:.|  ..|.|.|       |.|| |.||...|:||||
Mosquito    34 SKLLHKDEGAGYGGHSGYGGHS-SYGGHSGA--VGYQATV-------AVAP-VHYAPAPVAYAAP 87

  Fly    88 AQ-SYSAPA---ATYTAAASAPAVSYAAPAQSYSAPAATYTAAASAPA-VSYAAPAQS---YSAP 144
            |. :|:|||   ..|.|.|.|| |.|:||     |||..:.|.|.||| |.|:|||.:   ||||
Mosquito    88 APVAYAAPAPAPVQYAAPAPAP-VQYSAP-----APAPVHYAPAPAPAPVQYSAPAPAPVQYSAP 146

  Fly   145 A---ATYTAAASAPAVTYAAPAQT---YTAAASAPAVSYSAPAESYETAASEPAHTFSANDGYRY 203
            |   ..|:|.|.|| |.|:|||..   |:|.|.|| |.|:|||                      
Mosquito   147 APAPVQYSAPAPAP-VQYSAPAPAPVQYSAPAPAP-VQYAAPA---------------------- 187

  Fly   204 KTHKRVVLRRHRRGVPSNDYLPPFQGAASAPTSEYLPPAASAPAP 248
                                      .|..|...|.||||.||.|
Mosquito   188 --------------------------PAPVPAPVYGPPAAPAPYP 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11350NP_647910.1 GYR 198..215 CDD:426962 0/16 (0%)
GYR 296..313 CDD:426962
GYR 438..455 CDD:426962
LOC3290181XP_557177.2 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.