DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11350 and CG31626

DIOPT Version :10

Sequence 1:NP_647910.1 Gene:CG11350 / 38554 FlyBaseID:FBgn0035552 Length:456 Species:Drosophila melanogaster
Sequence 2:NP_724320.1 Gene:CG31626 / 318859 FlyBaseID:FBgn0051626 Length:285 Species:Drosophila melanogaster


Alignment Length:402 Identity:145/402 - (36%)
Similarity:170/402 - (42%) Gaps:128/402 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFFLF--CAFIAAVAADVSHLP-SSQYLPPGRGAASAPVASYSAPSQSYSVEASAPVASYSAPV 62
            ||.|:|  || ||..:||||||. .|.|             ||:.|:.:::: .|||..:|..||
  Fly     1 MKLFVFAVCA-IALASADVSHLNLGSGY-------------SYNKPTPTFNI-PSAPAPAYLPPV 50

  Fly    63 ESSYSVAASAPAVSYAAPAVSYAAPAQSYSAPAATYTAAASAPAVSYAAPAQSYSAPAATYTAAA 127
            :...|..|.||..|..|||..|:||     |||..|:|.|.||...|..|.|...|||..|:|.|
  Fly    51 QEVISAPAPAPVYSAPAPAPVYSAP-----APAPVYSAPAPAPVSEYLPPVQDIPAPAPVYSAPA 110

  Fly   128 SAPAVSYAAPAQSYSAPAATYTAAASAPAVTYAAPAQTYTAAASAPAVSYSAPAESYETAASEPA 192
            .||..|..|||..||||         |||..|..|.|...|.|.||.  |||||.:...:|..||
  Fly   111 PAPVYSAPAPAPVYSAP---------APAPEYLPPVQDIPAPAPAPV--YSAPAPAPVYSAPAPA 164

  Fly   193 HTFSANDGYRYKTHKRVVLRRHRRGVPSNDYLPPFQGAASAPTSEYLPPAAS--APAPVYQSAAS 255
            ..:||                                .|.||.||||||...  ||||||.:.|.
  Fly   165 PVYSA--------------------------------PAPAPVSEYLPPVQDIPAPAPVYSAPAP 197

  Fly   256 APAVSYAAPAQTYSAPAVSYAEPAESYETAASAPAHSFSSNDGYRYKTHKRVVLRRHRRDVSHLP 320
            ||..|..|||..|||||                                               |
  Fly   198 APVYSAPAPAPVYSAPA-----------------------------------------------P 215

  Fly   321 SNDYLPPA----ASAPAPVYSAPAQSYSAPAATYTAAASAPAVSYAAPAQSYSAPAATYTAAASA 381
            :.:||||.    |.||||||||||   .|||..|:|.|.||..|..|||..|||||...:     
  Fly   216 APEYLPPVQDLPAPAPAPVYSAPA---PAPAPVYSAPAPAPVYSAPAPAPVYSAPAPVES----- 272

  Fly   382 PAVSYSAPSQSY 393
             ...|:.|::.:
  Fly   273 -GYQYNVPAKRF 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11350NP_647910.1 GYR 198..215 CDD:426962 0/16 (0%)
GYR 296..313 CDD:426962 0/16 (0%)
GYR 438..455 CDD:426962
CG31626NP_724320.1 PRK12323 <45..>222 CDD:481241 91/271 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.