DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7465 and CG11131

DIOPT Version :9

Sequence 1:NP_647909.1 Gene:CG7465 / 38553 FlyBaseID:FBgn0035551 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001262228.1 Gene:CG11131 / 40511 FlyBaseID:FBgn0037204 Length:229 Species:Drosophila melanogaster


Alignment Length:295 Identity:119/295 - (40%)
Similarity:152/295 - (51%) Gaps:97/295 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLF-------LVAFAVIAAVAADVSHL--PSNEYLPPVQEQQIIAGPSNEYLPPVQAESAPAHE 56
            ||||       |||||  ||.:||.:..  ||:||||||.|                   |.|.:
  Fly     1 MKLFTAVLAICLVAFA--AAQSADPAAALEPSSEYLPPVGE-------------------AEAAQ 44

  Fly    57 LADDGYRYKTHKRVVVRRHRRDVNELFNEYLPPFA-APSNEYLAPAEGAP--ETILADDGYRYKT 118
            |:::||:|:|.:|:.: ||||:|..  .|||||.. |||.|||.|.:.|.  :|.:|||||||||
  Fly    45 LSENGYKYRTVRRLKL-RHRREVPN--QEYLPPVENAPSQEYLPPVDAAAIGDTKVADDGYRYKT 106

  Fly   119 HKRVVTR-RHRRDVSHLPSNEYLPPVQAAAPSNEYLPPVSAPVQVAAPAPAPVQIAAPVQLAAPA 182
            .:::..| |||||||.:           |.||.||||||.                  |:||...
  Fly   107 VRKLKFRARHRRDVSEI-----------AEPSGEYLPPVQ------------------VELAPEL 142

  Fly   183 PVVVEAEPAHELADDGYRYKTHRRVVYRRHRRD--VNELSNEYLPPFAAPSNEYLAPAETA---- 241
            ..:        |.||||:|||.||:.:|||||:  ..|.:.|     :||:.|||.|||.|    
  Fly   143 KTI--------LGDDGYKYKTVRRLKFRRHRREAVAEEAAAE-----SAPNGEYLPPAEAAAAAP 194

  Fly   242 ------PE-----TDLAVDGYRYKTHKRVVTR-RH 264
                  |:     |:||.|||||||.:|:..| ||
  Fly   195 AAAEAEPKSAEEGTELAKDGYRYKTVRRLRYRYRH 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7465NP_647909.1 GYR 111..128 CDD:128953 10/17 (59%)
GYR 249..265 CDD:128953 11/17 (65%)
CG11131NP_001262228.1 GYR 99..116 CDD:111632 9/16 (56%)
GYR 212..229 CDD:111632 9/16 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450156
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008548
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.