DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7465 and CG13705

DIOPT Version :9

Sequence 1:NP_647909.1 Gene:CG7465 / 38553 FlyBaseID:FBgn0035551 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_647938.1 Gene:CG13705 / 38587 FlyBaseID:FBgn0035582 Length:432 Species:Drosophila melanogaster


Alignment Length:477 Identity:182/477 - (38%)
Similarity:212/477 - (44%) Gaps:201/477 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLFLVAFAVIAAVAA------------------------------------------------- 16
            ||.|::|||||||.:|                                                 
  Fly     1 MKFFVIAFAVIAAASAASIATDYLPPVDNNLESASELVEVPAEQGVLSDDGYRYKTVRRLKLRHR 65

  Fly    17 -DVSHLPSNEYLPPVQE----------------------------QQIIAGPSNEYLPPVQ--AE 50
             ||:.|||.||||||:|                            ::.::..|.||||||:  |.
  Fly    66 RDVNELPSGEYLPPVEESASEAVAVETPLADDGYRYKTVRRVIRRRRDVSELSPEYLPPVEESAS 130

  Fly    51 SAPAHE--LADDGYRYKTHKRVVVRRHRRDVNELFNEYLPPFAAPSNEYLAPAEGAPETILADDG 113
            .|.|.|  ||||||||||.:||:  |.||||:||..|||||....::|.:     |.||.|||||
  Fly   131 EAVAVETPLADDGYRYKTVRRVI--RRRRDVSELSPEYLPPVEESASEAV-----AVETPLADDG 188

  Fly   114 YRYKTHKRVVTRRHRRDVSHLPSNEYLPPVQAAA------------------------------- 147
            |||||.:||:  |.|||||.| |.||||||:.:|                               
  Fly   189 YRYKTVRRVI--RRRRDVSEL-SPEYLPPVEESASEAVAVDTPLADDGYRYKTVRRVIRRRRDVN 250

  Fly   148 --PSNEYLPPV--SAPVQVAAPAPAPVQIAAPVQLAAPAPVVVEAEPAHELADDGYRYKTHRRVV 208
              ||.||||||  ||...||...|                          ||.|||||||.|||:
  Fly   251 ELPSGEYLPPVEESASEAVAVETP--------------------------LAADGYRYKTVRRVI 289

  Fly   209 YRRHRRDVNELSNEYLPPFAAPSNEYLAPAETAPETDLAVDGYRYKTHKRVVTRRHRRDVNELSN 273
              |.||||||||.|||||....::|     ..|.||.||.|||||||.:||:  |.||||:|||.
  Fly   290 --RRRRDVNELSAEYLPPVEESASE-----AVAVETPLADDGYRYKTVRRVI--RRRRDVSELSP 345

  Fly   274 EYLPPVQSA----------------------------------PSAEYLAPQENTVEA---APAH 301
            ||||||:.:                                  ||.|||.|.|.|..|   .||.
  Fly   346 EYLPPVEESASEAVAVETPLADDGYRYKTVRRVIRRRRDVSELPSGEYLPPVEETASAIIDVPAE 410

  Fly   302 --VLADDGYVYKTHKRVVLRRH 321
              |||.|||.|||.:|:.||||
  Fly   411 QTVLASDGYRYKTVRRLKLRRH 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7465NP_647909.1 GYR 111..128 CDD:128953 11/16 (69%)
GYR 249..265 CDD:128953 10/15 (67%)
CG13705NP_647938.1 GYR 49..66 CDD:128953 0/16 (0%)
GYR 417..432 CDD:128953 9/14 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450152
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CKD8
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008548
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.