DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KRT7 and LamC

DIOPT Version :9

Sequence 1:NP_005547.3 Gene:KRT7 / 3855 HGNCID:6445 Length:469 Species:Homo sapiens
Sequence 2:NP_001260974.1 Gene:LamC / 36615 FlyBaseID:FBgn0010397 Length:640 Species:Drosophila melanogaster


Alignment Length:506 Identity:128/506 - (25%)
Similarity:217/506 - (42%) Gaps:112/506 - (22%)


- Green bases have known domain annotations that are detailed below.


Human    25 RLSSARPGGLGSSSLYGLGASRPRVAVRSAYGGPVGAGIREVTINQSLLAPLRLDADPSLQRVRQ 89
            |.|::.|.| |:|:...:||:.|....|::                                 ||
  Fly    14 RASTSTPVG-GASTSSRVGATSPTSPTRTS---------------------------------RQ 44

Human    90 EESEQIKTLNNKFASFIDKVRFLEQQNKLLETKWTLLQEQKSAKSSRLPDIFEAQIAGLRGQLEA 154
            :|.|:::.||::.|.:||::|.||.:|..|..:..|.|:..:.::|.|..::|.::|..|..|:.
  Fly    45 QEKEELQHLNDRLACYIDRMRNLENENSRLTQELNLAQDTVNRETSNLKAVYEKELAAARKLLDE 109

Human   155 LQVDGGRLEAELRSMQDVVEDFKNKYEDEINHRTAAEN--------------------------- 192
            ...:..:||.:::.:.:..:|.|.:.:.:....|.|||                           
  Fly   110 TAKEKAKLEIDIKRLWEENDDLKPRLDKKTKEATVAENNARLYENRYNEVNGKYNQSLADRKKFE 174

Human   193 ----EFVV-----------LKKDVDAAYMSKVELEAKVDALNDEINFLRTLNETELTELQS--QI 240
                |..:           |:|.::|..:::|:||.:..:|.:|:.|...::..||||.:|  ||
  Fly   175 DQAKELALENERLRRQLDDLRKQLEAETLARVDLENQNQSLREELAFKDQVHTQELTETRSRRQI 239

Human   241 SDTSVVLSMDNSRSLDLDGIIAEVKAQYEEMAKCSRAEAEAWYQTKFETLQAQAGKHGDDLRNTR 305
            ..:.:...:.......|...:.|::.|||...:.:|.|.|..|..:.:.|:|.|.:.........
  Fly   240 EISEIDGRLSRQYEAKLQQSLQELRDQYEGQMRINREEIELLYDNEIQNLKAAANRAAQGSALAT 304

Human   306 NEISEMNRAIQRLQAEIDNIKNQRAKLEAAIAEAEERGELALKDARAKQE-----ELEAALQRGK 365
            .|:..|...|..|.|::.|:::..|.|.|.|.|.|.     |.|...::.     .|||.|||.:
  Fly   305 EEVRLMRTKIDGLNAKLQNLEDTNAGLNARIRELEN-----LLDTERQRHNQYIASLEAELQRMR 364

Human   366 QDMARQLREYQELMSVKLALDIEIATYRKLLEGEESRLAGDGVGAVNISVMNSTGGSSSGGGIGL 430
            .:||.||:|||.||.:|::||:|||.|.|||.|||.||..:..|...    ..:|.||:|..:..
  Fly   365 DEMAHQLQEYQGLMDIKVSLDLEIAAYDKLLCGEERRLNIESPGRPT----TDSGISSNGSHLTA 425

Human   431 TLGGTMGSNALSFSSSAGPGL--------------------LKAYSIRTAS 461
            :.....|....|...||.||:                    |..||:..|:
  Fly   426 SASSRSGRVTPSGRRSATPGISGSSAVKRRRTVIDESEDRTLSEYSVNAAA 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KRT7NP_005547.3 Keratin_2_head 1..87 CDD:292825 10/61 (16%)
Head 2..90 11/64 (17%)
DUF4081 <15..95 CDD:290051 14/69 (20%)
Filament 90..402 CDD:278467 99/360 (28%)
Coil 1A 90..126 12/35 (34%)
Interaction with HPV16 E7. /evidence=ECO:0000269|PubMed:12072504 92..97 1/4 (25%)
Linker 1 127..144 4/16 (25%)
Coil 1B 145..236 24/132 (18%)
Linker 12 237..260 4/24 (17%)
Coil 2 261..399 50/142 (35%)
Tail 400..469 18/82 (22%)
LamCNP_001260974.1 Filament 45..401 CDD:278467 99/360 (28%)
ATP-synt_B <67..>142 CDD:304375 16/74 (22%)
MreC <178..>224 CDD:302802 10/45 (22%)
LTD 473..574 CDD:279300 1/4 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.