DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15022 and and3

DIOPT Version :9

Sequence 1:NP_647905.1 Gene:CG15022 / 38549 FlyBaseID:FBgn0035547 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001020682.1 Gene:and3 / 561047 ZFINID:ZDB-GENE-040724-185 Length:295 Species:Danio rerio


Alignment Length:275 Identity:78/275 - (28%)
Similarity:101/275 - (36%) Gaps:69/275 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 HGHDHHHHHDHDHDHDHHHY----DVHSHHHSPSSHDHHD---------------LHIDLHYQPD 77
            |.||...|.......|.:.|    |..|::...:|..|.:               .|::|.|.||
Zfish    51 HAHDFLAHARQRRSVDPNWYRKNPDFQSYYRYYNSIGHTEGLYEIDKIRMLYQQMRHLELTYGPD 115

  Fly    78 HHHHHHQEAKFDIPSGYSYGPPEKPRQKYLPPKVSLPPPPPPPP----KATYL-----PPSKPEV 133
                   .:|:....|.      ||    .||..:.||||..||    ...||     |..||.:
Zfish   116 -------ASKYQNTLGL------KP----TPPPTTQPPPPTLPPVSKMNVIYLCNSKDPQCKPHI 163

  Fly   134 KYLPPEPVAKYLPPKVAPS--LPP---PPPPPVVAPKPTYLPPSPPESKYLPPPTPEVKYLPPAP 193
            .|||...|.....|:..|:  |.|   .|.|||:.|:|....|.||..|..|||.|     ||..
Zfish   164 VYLPAGGVPVLCDPRYHPNCKLSPAQNSPSPPVIVPEPVTTVPLPPTQKSTPPPPP-----PPIM 223

  Fly   194 VARYLPPKVAPSLPP----PPPPPPVAPKKLYLPPAEPETKYLPPSEPVEKYLPPKPEQKYLPPQ 254
            |.:.:.....|...|    ..||.||   |:..|.:|      .|.|.|:|.:|..|...|.|..
Zfish   224 VVKGMEYDCDPYWDPDCLIDNPPRPV---KMVEPSSE------LPDEKVKKEIPVDPVPTYDPYD 279

  Fly   255 PEVDFHIPIPSYALP 269
            ...|.:.|. .:|.|
Zfish   280 FNQDLYDPF-RHAAP 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15022NP_647905.1 PHA03247 <128..276 CDD:223021 48/151 (32%)
and3NP_001020682.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.