DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15021 and Mmp23

DIOPT Version :9

Sequence 1:NP_647902.1 Gene:CG15021 / 38546 FlyBaseID:FBgn0035544 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_446058.1 Gene:Mmp23 / 94339 RGDID:620201 Length:391 Species:Rattus norvegicus


Alignment Length:35 Identity:12/35 - (34%)
Similarity:14/35 - (40%) Gaps:6/35 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   385 PTPEYGPP--PPTSG----GDEAGSLGPDGYNYNK 413
            ||.|....  ||..|    ..|...|||..|::.|
  Rat   165 PTGELAHAFFPPHGGIHFDDSEYWVLGPTRYSWKK 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15021NP_647902.1 None
Mmp23NP_446058.1 Peptidase_M10 88..255 CDD:278824 12/35 (34%)
ZnMc_MMP 88..255 CDD:239805 12/35 (34%)
ShKT 256..290 CDD:214586
Ig 314..376 CDD:299845
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1565
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.