DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15021 and MMP20

DIOPT Version :9

Sequence 1:NP_647902.1 Gene:CG15021 / 38546 FlyBaseID:FBgn0035544 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_004762.2 Gene:MMP20 / 9313 HGNCID:7167 Length:483 Species:Homo sapiens


Alignment Length:54 Identity:16/54 - (29%)
Similarity:21/54 - (38%) Gaps:9/54 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   320 PAPAPGPTYQPRPP----APPAPAPG--PTYQPRP---PSPPAPPAPTYQPQPP 364
            |:....|||:.:.|    .|.....|  ..|.||.   ..|..|.||.::|..|
Human   240 PSALMYPTYKYKNPYGFHLPKDDVKGIQALYGPRKVFLGKPTLPHAPHHKPSIP 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15021NP_647902.1 None
MMP20NP_004762.2 PG_binding_1 35..95 CDD:279773
Cysteine switch. /evidence=ECO:0000250 98..105
Peptidase_M10 116..271 CDD:278824 7/30 (23%)
ZnMc_MMP 116..271 CDD:239805 7/30 (23%)
HX 293..483 CDD:238046 1/1 (100%)
Hemopexin 1 293..343 1/1 (100%)
Hemopexin 2 344..389
Hemopexin 3 391..439
Hemopexin 4 440..483
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1565
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.