DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15021 and MMP23B

DIOPT Version :9

Sequence 1:NP_647902.1 Gene:CG15021 / 38546 FlyBaseID:FBgn0035544 Length:420 Species:Drosophila melanogaster
Sequence 2:XP_016858104.1 Gene:MMP23B / 8510 HGNCID:7171 Length:526 Species:Homo sapiens


Alignment Length:127 Identity:35/127 - (27%)
Similarity:45/127 - (35%) Gaps:40/127 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 PRPPPQPTPSAPAPPPPS------YGPPQTPPPRPPPQPTPSAPAPPPSYGPPQTPPPRPPPQPT 159
            |||..||.|...|..|.:      .|.|:           |.|.....:...|..|||     |.
Human   113 PRPAVQPLPLHWAAFPGTCNRALRLGDPK-----------PQADRTRHARSQPWAPPP-----PF 161

  Fly   160 PSAP--APSYGPPQPQPPAPQPPS--------------PPSPQPGPEYLPPDQPKPRPTPSR 205
            ||:|  |..:||.......|:..|              ||:..|||  |.|.:.:...||:|
Human   162 PSSPFSAAVFGPGDRHRCLPRTLSSLKGDVAALGLSAVPPTRVPGP--LAPRRRRYTLTPAR 221



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1565
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.