DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15021 and mmp24

DIOPT Version :9

Sequence 1:NP_647902.1 Gene:CG15021 / 38546 FlyBaseID:FBgn0035544 Length:420 Species:Drosophila melanogaster
Sequence 2:XP_699803.4 Gene:mmp24 / 571143 ZFINID:ZDB-GENE-040724-262 Length:606 Species:Danio rerio


Alignment Length:168 Identity:41/168 - (24%)
Similarity:51/168 - (30%) Gaps:65/168 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VALLLAAGVHADVSHLDTDLQEDGY--HYKQPSVPFPPPG--------------SGNGIEDS--- 53
            :.:..|:|.|.|.|..|   .|.|:  |     ..||.||              .||...|.   
Zfish   180 IMIFFASGFHGDSSPFD---GEGGFLAH-----AYFPGPGIGGDTHFDSDEPWTLGNANHDGNDL 236

  Fly    54 ------------GIGPGPAPSA-PAPSYGPPQTR------------------PPP--PPPPPQPT 85
                        |:.....||| .||.|...:|.                  |..  .|..|.||
Zfish   237 FLVAVHELGHALGLEHSSDPSAIMAPFYQYMETHNFKLPLDDLQGIQKIYGIPTAMLEPTRPLPT 301

  Fly    86 PPAPRPSYGPP-----QTQPPRPPPQPTPSAPAPPPPS 118
            .||.||.....     |::|.||.....||:|....|:
Zfish   302 FPARRPHSTSERKHERQSRPGRPSAGDRPSSPGHGKPN 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15021NP_647902.1 None
mmp24XP_699803.4 PG_binding_1 41..94 CDD:279773
Peptidase_M10 122..287 CDD:278824 24/114 (21%)
ZnMc_MMP 122..287 CDD:239805 24/114 (21%)
HX 338..530 CDD:238046 1/2 (50%)
DUF3377 536..606 CDD:288690
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1565
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.