DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15021 and mmp14b

DIOPT Version :9

Sequence 1:NP_647902.1 Gene:CG15021 / 38546 FlyBaseID:FBgn0035544 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_919395.1 Gene:mmp14b / 566945 ZFINID:ZDB-GENE-030901-2 Length:621 Species:Danio rerio


Alignment Length:175 Identity:44/175 - (25%)
Similarity:48/175 - (27%) Gaps:69/175 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VALLLAAGVHADVSHLDTDLQEDGY--HYKQPSVPFPPPGSGNGIEDS----------------- 53
            :.|..|.|.|.|.|..|   .|.|:  |     ..||    ||||...                 
Zfish   170 IMLFFADGFHGDASPFD---GEGGFLAH-----AYFP----GNGIGGDTHFDAAEPWTIGNKDLL 222

  Fly    54 ----------------GIGPGPAPSA-PAPSYGPPQTRPPPPPPPPQPTPPAPRPSYGPPQTQPP 101
                            |:.....||| .||.|   |.........|.......:..|||.....|
Zfish   223 GNDVFLVAVHELGHALGMEHSNDPSAIMAPFY---QWMETDHFVLPDDDRKGIQKLYGPGSGGHP 284

  Fly   102 RPPPQPTPSAPAPPPPSYGPPQTPPPRPPPQPTPSAPAPPPSYGP 146
            |||..|                 ..|...|.|||..|. .|||||
Zfish   285 RPPVSP-----------------ETPHHTPYPTPYRPG-GPSYGP 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15021NP_647902.1 None
mmp14bNP_919395.1 PG_binding_1 29..81 CDD:279773
Peptidase_M10 111..277 CDD:278824 25/121 (21%)
ZnMc_MMP 111..277 CDD:239805 25/121 (21%)
HX 311..503 CDD:238046 1/1 (100%)
DUF3377 563..621 CDD:288690
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1565
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.