DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15021 and mmp15a

DIOPT Version :9

Sequence 1:NP_647902.1 Gene:CG15021 / 38546 FlyBaseID:FBgn0035544 Length:420 Species:Drosophila melanogaster
Sequence 2:XP_001924042.4 Gene:mmp15a / 561041 ZFINID:ZDB-GENE-070817-4 Length:651 Species:Danio rerio


Alignment Length:184 Identity:46/184 - (25%)
Similarity:56/184 - (30%) Gaps:70/184 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 PLVALLLAAGVHADVSHLDTDLQEDGYHYKQPSVPFPPPGSG-------------NGIEDSGIG- 56
            |.:.||.|:|.|.|:|..|.:.....:.:      ||.||.|             |..|.||:. 
Zfish   174 PDIILLFASGYHGDMSLFDGEGGSLAHAF------FPGPGMGGDTHFDTDEPWTLNQQEGSGVDL 232

  Fly    57 -------PGPA--------PSA-PAP----------------------SYGPPQTRPPPPPP--- 80
                   .|.|        ||| .||                      .||.|:|......|   
Zfish   233 FLVAVHELGHALGLEHSNNPSAIMAPFYQWMDTESFALADDDINGIHQIYGSPETVTTQAAPTTT 297

  Fly    81 ------PPQPTPPAPRPSYGPPQTQPPR---PPPQPTPSAPAPPPPSYGPPQTP 125
                  .|:||....:|....|..||.|   ||..||.....|.|.|......|
Zfish   298 LFTTTAKPEPTTTEAQPKTTRPSLQPTRPWVPPVNPTRRTYRPQPTSRSNQDAP 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15021NP_647902.1 None
mmp15aXP_001924042.4 PG_binding_1 34..88 CDD:279773
Peptidase_M10 118..283 CDD:278824 25/114 (22%)
ZnMc_MMP 118..283 CDD:239805 25/114 (22%)
HX 351..542 CDD:238046 1/1 (100%)
DUF3377 589..651 CDD:288690
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1565
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.