DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15021 and vtna

DIOPT Version :9

Sequence 1:NP_647902.1 Gene:CG15021 / 38546 FlyBaseID:FBgn0035544 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001018508.1 Gene:vtna / 553699 ZFINID:ZDB-GENE-050522-440 Length:514 Species:Danio rerio


Alignment Length:64 Identity:21/64 - (32%)
Similarity:27/64 - (42%) Gaps:4/64 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 PPRPPPQPTPSAPAPPPPSYGPPQTPPPRPPPQPTP--SAPAPPPSYGPPQTPPPRPPPQPTPS 161
            |.|..||....:|:|...|  ...||......:|||  :..|.|.:..|..||......||||:
Zfish    82 PIRSRPQVRVLSPSPLEIS--SMVTPVLDTANEPTPVIATAATPTNKNPATTPGATTTAQPTPT 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15021NP_647902.1 None
vtnaNP_001018508.1 Somatomedin_B 19..56 CDD:279385
HX 151..>299 CDD:238046
HX <469..504 CDD:214524
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1565
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.