DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15021 and MMP15

DIOPT Version :9

Sequence 1:NP_647902.1 Gene:CG15021 / 38546 FlyBaseID:FBgn0035544 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_002419.1 Gene:MMP15 / 4324 HGNCID:7161 Length:669 Species:Homo sapiens


Alignment Length:193 Identity:54/193 - (27%)
Similarity:62/193 - (32%) Gaps:76/193 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VALLLAAGVHADVSHLDTDLQEDGYHYKQPSVPFPPPGSGN------------------------ 48
            :.:|.|:|.|.|.|..|.......:.|      ||.||.|.                        
Human   197 IMVLFASGFHGDSSPFDGTGGFLAHAY------FPGPGLGGDTHFDADEPWTFSSTDLHGNNLFL 255

  Fly    49 ----------GIEDSGIGPGPAPSAP-----------APS---------YGPPQTRPPPPPPPPQ 83
                      |:|.|. .|. |..||           .|.         ||.|..:|.|..|.|.
Human   256 VAVHELGHALGLEHSS-NPN-AIMAPFYQWKDVDNFKLPEDDLRGIQQLYGTPDGQPQPTQPLPT 318

  Fly    84 PTPPAPRPSYGPPQTQPPRPPPQPTPSAPAPPPPSYGPPQTPPPRPPPQPTPSAPAPPPSYGP 146
            .||..|    |.|..:||||        |.||||...|.:.|.|.||.|  |.|...|..|||
Human   319 VTPRRP----GRPDHRPPRP--------PQPPPPGGKPERPPKPGPPVQ--PRATERPDQYGP 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15021NP_647902.1 None
MMP15NP_002419.1 PG_binding_1 53..106 CDD:279773
Cysteine switch. /evidence=ECO:0000250 109..116
Peptidase_M10 138..304 CDD:278824 21/114 (18%)
ZnMc_MMP 138..304 CDD:239805 21/114 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 300..370 33/82 (40%)
HX 367..559 CDD:238046 1/1 (100%)
Hemopexin 1 367..415 1/1 (100%)
Hemopexin 2 416..461
Hemopexin 3 463..511
Hemopexin 4 512..559
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 574..593
DUF3377 <644..669 CDD:288690
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1565
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.