powered by:
Protein Alignment CG15021 and MMP12
DIOPT Version :9
Sequence 1: | NP_647902.1 |
Gene: | CG15021 / 38546 |
FlyBaseID: | FBgn0035544 |
Length: | 420 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_002417.2 |
Gene: | MMP12 / 4321 |
HGNCID: | 7158 |
Length: | 470 |
Species: | Homo sapiens |
Alignment Length: | 51 |
Identity: | 12/51 - (23%) |
Similarity: | 15/51 - (29%) |
Gaps: | 21/51 - (41%) |
- Green bases have known domain annotations that are detailed below.
Fly 8 VALLLAAGVHADVSHLDTDLQEDGYHYKQPSVPFPPPGSGNGIEDSGIGPG 58
:.::.|.|.|.|....| |.| ||.....|||
Human 159 ILVVFARGAHGDFHAFD--------------------GKG-GILAHAFGPG 188
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1565 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.