DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15021 and MMP1

DIOPT Version :9

Sequence 1:NP_647902.1 Gene:CG15021 / 38546 FlyBaseID:FBgn0035544 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_002412.1 Gene:MMP1 / 4312 HGNCID:7155 Length:469 Species:Homo sapiens


Alignment Length:59 Identity:13/59 - (22%)
Similarity:19/59 - (32%) Gaps:22/59 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GVHADVSHLDTDLQEDGY---------------HYKQPSVPFPP-------PGSGNGIE 51
            |....|.|:|..|.|:..               .||:...|..|       ||.|:.::
Human   369 GFPRTVKHIDAALSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMIAHDFPGIGHKVD 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15021NP_647902.1 None
MMP1NP_002412.1 PG_binding_1 27..87 CDD:396175
Cysteine switch. /evidence=ECO:0000269|PubMed:15611040, ECO:0000269|PubMed:2153297 90..97
Metalloprotease 98..276
Peptidase_M10 108..261 CDD:395334
HX 275..466 CDD:238046 13/59 (22%)
Hemopexin 1 275..324
Hemopexin 2 325..371 1/1 (100%)
Hemopexin 3 374..422 10/47 (21%)
Hemopexin 4 423..466 1/5 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1565
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.