DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15021 and Mmp1

DIOPT Version :9

Sequence 1:NP_647902.1 Gene:CG15021 / 38546 FlyBaseID:FBgn0035544 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001128002.1 Gene:Mmp1 / 300339 RGDID:1307917 Length:464 Species:Rattus norvegicus


Alignment Length:39 Identity:14/39 - (35%)
Similarity:16/39 - (41%) Gaps:11/39 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   383 PAPTPEYG-----PPPPTSGG------DEAGSLGPDGYN 410
            |...||||     ||.|..||      ||..:...|.:|
  Rat   170 PFDGPEYGLAHTFPPGPRLGGDVHYDLDETWTDNSDNFN 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15021NP_647902.1 None
Mmp1NP_001128002.1 PG_binding_1 26..84 CDD:279773
Peptidase_M10 105..259 CDD:278824 14/39 (36%)
ZnMc_MMP 105..259 CDD:239805 14/39 (36%)
HX 273..464 CDD:238046
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1565
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.