powered by:
Protein Alignment CG15021 and Mmp23
DIOPT Version :9
Sequence 1: | NP_647902.1 |
Gene: | CG15021 / 38546 |
FlyBaseID: | FBgn0035544 |
Length: | 420 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_006538942.1 |
Gene: | Mmp23 / 26561 |
MGIID: | 1347361 |
Length: | 420 |
Species: | Mus musculus |
Alignment Length: | 35 |
Identity: | 12/35 - (34%) |
Similarity: | 14/35 - (40%) |
Gaps: | 6/35 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 385 PTPEYGPP--PPTSG----GDEAGSLGPDGYNYNK 413
||.|.... ||..| ..|...|||..|::.|
Mouse 194 PTGELAHAFFPPHGGIHFDDSEYWVLGPTRYSWKK 228
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG15021 | NP_647902.1 |
None |
Mmp23 | XP_006538942.1 |
ZnMc_MMP |
88..284 |
CDD:239805 |
12/35 (34%) |
ShKT |
285..319 |
CDD:214586 |
|
Ig |
343..403 |
CDD:386229 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1565 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.