DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15021 and Mmp7

DIOPT Version :9

Sequence 1:NP_647902.1 Gene:CG15021 / 38546 FlyBaseID:FBgn0035544 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_036996.1 Gene:Mmp7 / 25335 RGDID:3100 Length:267 Species:Rattus norvegicus


Alignment Length:47 Identity:12/47 - (25%)
Similarity:14/47 - (29%) Gaps:21/47 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 AAGVHADVSHLDTDLQEDGYHYKQPSVPFPPPGSGNGIEDSGIGPGP 59
            |.|.|.|                  :.||..||:..|   ....|||
  Rat   162 ARGDHGD------------------NFPFDGPGNTLG---HAFAPGP 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15021NP_647902.1 None
Mmp7NP_036996.1 PG_binding_1 34..85 CDD:396175
Cysteine switch. /evidence=ECO:0000250 88..95
Peptidase_M10 106..262 CDD:395334 12/47 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1565
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.