DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15021 and Vtn

DIOPT Version :9

Sequence 1:NP_647902.1 Gene:CG15021 / 38546 FlyBaseID:FBgn0035544 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_035837.1 Gene:Vtn / 22370 MGIID:98940 Length:478 Species:Mus musculus


Alignment Length:72 Identity:21/72 - (29%)
Similarity:26/72 - (36%) Gaps:11/72 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   275 EYLPPPGENEVTPTQPQPTAPVPEYGPP-----PPAPPAGPTYQPRPPAPPAP------APGPTY 328
            :|:..|..|..|..||:.|:|..:..|.     .|.....|..||..|||...      .|..|.
Mouse    79 DYVEEPKNNTNTGVQPENTSPPGDLNPRTDGTLKPTAFLDPEEQPSTPAPKVEQQEEILRPDTTD 143

  Fly   329 QPRPPAP 335
            |..|..|
Mouse   144 QGTPEFP 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15021NP_647902.1 None
VtnNP_035837.1 SO 20..62 CDD:197571
Cell attachment site 64..66
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 82..153 20/69 (29%)
HX 153..473 CDD:238046
Hemopexin 1 157..201
Hemopexin 2 202..249
Hemopexin 3 250..304
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 359..395
Heparin-binding. /evidence=ECO:0000250 366..399
Hemopexin 4 420..473
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1565
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.