DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15021 and Mmp21

DIOPT Version :9

Sequence 1:NP_647902.1 Gene:CG15021 / 38546 FlyBaseID:FBgn0035544 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_694423.1 Gene:Mmp21 / 214766 MGIID:2664387 Length:568 Species:Mus musculus


Alignment Length:108 Identity:30/108 - (27%)
Similarity:35/108 - (32%) Gaps:29/108 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 DLQEDGYHYKQPSVPFPPPGSG-----------------NGIEDSGIGPGPAPSA-PAPSYGPPQ 72
            |.|.....|....:|.|...:|                 |.:..||....|..:| ..|..|.|.
Mouse    52 DAQSFLLKYGWSEIPSPKESAGVPVGFTLAQAVRRFQKANRLPASGELDSPTLAAMNKPRCGVPD 116

  Fly    73 TRPPPPPPPPQPTPPAPRPSYG--PPQTQP-------PRPPPQ 106
            ||  .||....|||||...|.|  |...|.       |:|..|
Mouse   117 TR--LPPRAALPTPPALLTSLGLRPRARQKRFLQMLFPKPDGQ 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15021NP_647902.1 None
Mmp21NP_694423.1 PG_binding_1 48..107 CDD:279773 10/54 (19%)
Cysteine switch. /evidence=ECO:0000250 110..117 3/6 (50%)
Peptidase_M10 169..326 CDD:278824
ZnMc_MMP 170..326 CDD:239805
HX 328..544 CDD:238046
Hemopexin 1 329..388
Hemopexin 2 390..446
Hemopexin 3 447..495
Hemopexin 4 502..558
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1565
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.