DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15021 and Mmp9

DIOPT Version :9

Sequence 1:NP_647902.1 Gene:CG15021 / 38546 FlyBaseID:FBgn0035544 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_038627.1 Gene:Mmp9 / 17395 MGIID:97011 Length:730 Species:Mus musculus


Alignment Length:165 Identity:53/165 - (32%)
Similarity:60/165 - (36%) Gaps:50/165 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   273 GSEYL------PPPGENEVTPTQPQPTAPVPEYGP--PPPA-PPAGPTYQPRPPAPPAPAPGPTY 328
            |.:||      |.|.....|.|:|||||| |...|  ||.| |..|||..|    ..||:||||.
Mouse   438 GIQYLYGRGSKPDPRPPATTTTEPQPTAP-PTMCPTIPPTAYPTVGPTVGP----TGAPSPGPTS 497

  Fly   329 QPRPPAPPAPAPGPTYQPRPPSPPAPPAPTYQPQPPAPP-------------------------- 367
            .|.|....||:||||   .||:..:..|.|....|...|                          
Mouse   498 SPSPGPTGAPSPGPT---APPTAGSSEASTESLSPADNPCNVDVFDAIAEIQGALHFFKDGWYWK 559

  Fly   368 ------APAPGPTYQPRP-PAPPAPTPEYGPPPPT 395
                  :|..||....|. ||.||........|.|
Mouse   560 FLNHRGSPLQGPFLTARTWPALPATLDSAFEDPQT 594

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15021NP_647902.1 None
Mmp9NP_038627.1 PG_binding_1 41..95 CDD:279773
Cysteine switch. /evidence=ECO:0000250|UniProtKB:P14780 98..105
Peptidase_M10 115..444 CDD:278824 3/5 (60%)
ZnMc_MMP 115..444 CDD:239805 3/5 (60%)
FN2 223..271 CDD:128373
FN2 281..329 CDD:128373
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 442..529 39/94 (41%)
PT 474..525 CDD:282710 25/57 (44%)
HX 532..729 CDD:238046 11/63 (17%)
Hemopexin 1 536..581 5/44 (11%)
Hemopexin 2 582..626 4/13 (31%)
Hemopexin 3 628..675
Hemopexin 4 676..729
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1565
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.