DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15021 and mmp15b

DIOPT Version :9

Sequence 1:NP_647902.1 Gene:CG15021 / 38546 FlyBaseID:FBgn0035544 Length:420 Species:Drosophila melanogaster
Sequence 2:XP_021323108.1 Gene:mmp15b / 100332426 ZFINID:ZDB-GENE-070817-6 Length:655 Species:Danio rerio


Alignment Length:179 Identity:48/179 - (26%)
Similarity:62/179 - (34%) Gaps:53/179 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 PLVALLLAAGVHADVSHLDTDLQEDGY--HYKQPSVPFPPPGSGN-------------------- 48
            |.:.:..|:|.|.|.|..|   .|.|:  |     ..||.||.|.                    
Zfish   179 PDIMIFFASGFHGDSSPFD---GEGGFLAH-----AYFPGPGMGGDTHFDSDEPWTIGSQNLQGN 235

  Fly    49 --------------GIEDSGIGPGPAPSAPAPSYGPPQTRPPPPPPPPQPTPPAPRPSYGPPQTQ 99
                          |:|.|.   .|. :..||.|   |.........|:......:..||||.:.
Zfish   236 DLFLVAVHELGHALGLEHSN---NPL-AIMAPFY---QWMDTENFELPEDDLRGVQQIYGPPSSS 293

  Fly   100 PPRPPPQPTPSAPA-PPPPSYGPPQTPPPRPPPQP-TPSAPAPPPSYGP 146
            |.:..|..||..|| |.|.:..||::||..||.:| .|.....|..|||
Zfish   294 PTQALPTVTPRRPAHPDPRAPNPPKSPPGAPPRRPDKPRTTDRPDHYGP 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15021NP_647902.1 None
mmp15bXP_021323108.1 PG_binding_1 40..92 CDD:307564
Peptidase_M10 122..288 CDD:306839 24/123 (20%)
HX 342..535 CDD:238046 1/1 (100%)
DUF3377 596..655 CDD:314687
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1565
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.