powered by:
Protein Alignment CG15021 and mmp25a
DIOPT Version :9
Sequence 1: | NP_647902.1 |
Gene: | CG15021 / 38546 |
FlyBaseID: | FBgn0035544 |
Length: | 420 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_021327128.1 |
Gene: | mmp25a / 100001739 |
ZFINID: | ZDB-GENE-070820-22 |
Length: | 514 |
Species: | Danio rerio |
Alignment Length: | 31 |
Identity: | 12/31 - (38%) |
Similarity: | 13/31 - (41%) |
Gaps: | 8/31 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 115 PPPSYGPPQTPPPR--------PPPQPTPSA 137
||||...|.|.|.: ||..|..||
Zfish 236 PPPSVAAPTTYPTQFSTTYLLHPPYYPPDSA 266
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG15021 | NP_647902.1 |
None |
mmp25a | XP_021327128.1 |
ZnMc_MMP |
61..229 |
CDD:239805 |
|
HX |
267..466 |
CDD:238046 |
12/31 (39%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1565 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.