DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nAChRbeta1 and lgc-21

DIOPT Version :9

Sequence 1:NP_523927.2 Gene:nAChRbeta1 / 38545 FlyBaseID:FBgn0000038 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_510341.2 Gene:lgc-21 / 181516 WormBaseID:WBGene00007903 Length:462 Species:Caenorhabditis elegans


Alignment Length:295 Identity:64/295 - (21%)
Similarity:117/295 - (39%) Gaps:52/295 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 QKVGVRFGLAFVQLINVNEKNQIMKSNVWLRLVWYDYQLQWDEADYGGIGVLRLPPDKVWKPDIV 115
            |.|.:.|....:|...:||..:.:..:.:|.|.|:|.:|.|::..:....::......:|.|.:.
 Worm   111 QPVTINFAQFTLQHFELNEHLKDISIHGYLELSWHDDRLMWNQDTWKKNKLVVHSFHHIWVPLLG 175

  Fly   116 LFN------NADGNYEVRYKSNVLIYPTGEVLWVPPAIYQSSC-TIDVTYFPFDQQTCIMKFG-- 171
            ..|      |.|. :|:|   .|.....|.|........::.| ..|...:|.|...|...|.  
 Worm   176 SQNPENHLKNGDA-FEIR---KVETTNQGNVSAKVAFSLRTFCDDTDFENYPNDVYKCCFSFEPQ 236

  Fly   172 ------SWTFNGDQVSLALYNN-KNFVDLSDYW-KSGTWDIIEVPAYLNVYEGDSNHPTE-TDIT 227
                  .:|.:|    |.::.: |||.|..  | .|||     ||.       ..:.|:| ..:.
 Worm   237 QDREVIQFTSSG----LPIFTDPKNFRDYG--WGVSGT-----VPE-------SFDDPSEIAQLG 283

  Fly   228 FYIIIRRKTLFYTVNLILPTVLISFLCVLVFYLPAEAGE-KVTLGISI------LLSLVVFLLLV 285
            |.:.::|......:.|.:|.    |:...:|.||...|. |:.:.:.:      .::|::|...:
 Worm   284 FCLNLKRAHSSLKIELAIPL----FITTALFLLPPLFGSVKIQIYLKMFVMGLQFMTLLIFSTRI 344

  Fly   286 SKILPPTSLVLPLIAKYLLFTFIMNTVSILVTVII 320
            :..|..|:.. |...::|....:.|.:||..::||
 Worm   345 APFLSSTAST-PKPMRFLEIALVFNLISITTSIII 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nAChRbeta1NP_523927.2 LIC 8..500 CDD:273305 64/295 (22%)
Neur_chan_LBD 28..236 CDD:280998 45/202 (22%)
Neur_chan_memb 243..498 CDD:280999 19/85 (22%)
lgc-21NP_510341.2 LGIC_ECD 113..290 CDD:355788 43/198 (22%)
Cys-loop 214..229 CDD:349787 4/14 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.