DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15020 and qsm

DIOPT Version :9

Sequence 1:NP_647901.1 Gene:CG15020 / 38544 FlyBaseID:FBgn0035543 Length:604 Species:Drosophila melanogaster
Sequence 2:NP_001286637.1 Gene:qsm / 47065 FlyBaseID:FBgn0028622 Length:414 Species:Drosophila melanogaster


Alignment Length:424 Identity:91/424 - (21%)
Similarity:139/424 - (32%) Gaps:98/424 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   211 QHNGTRVQHIEAECQDDYMKIRIGFNGSFS-----GLLYSAGYAYDPD--CM-YING-------S 260
            |..|:...|    |.:|.|::.||...:.|     ..:|..|....||  |. .|:|       |
  Fly    22 QAKGSHKVH----CSEDQMRVDIGLPDAESKDQSAPQIYLEGLKGYPDERCQPQIDGSLAVFRLS 82

  Fly   261 GRDYYEFYIQLNRCGT-------LGKN------SLQEESRKNPTNFMW-NTVTVQYNPLIEEEYD 311
            ..|:||       ||.       .||.      .::..|.|...:... .|.:..||.::.....
  Fly    83 LSDFYE-------CGVTRMVNQLTGKKVYYHKIIIESTSGKEIVSVKCITTASPAYNVMMNATTG 140

  Fly   312 EHFKVTCEYG-YDFWKTVTFPF-----LDVEVATGNPVVFTLSPPECYMEIQNGYGIGGPRVTG- 369
            .....|...| :...|....|.     .|:|:.|.    .|...||..:.|  |....|.:.|. 
  Fly   141 SSSTSTSSGGIHGLVKRDVLPAGFQEPEDLEITTS----LTKRAPEPRLSI--GVSQDGQKFTRD 199

  Fly   370 -PVRVGDPLTLIIYM-RSKYDGFDIVVNDCYAHNGANKRIQLIDQH---------GCPVDDKLIS 423
             .|:.|.|||:.|.: ......:.:.||          .:.:.|.|         ||.||..|..
  Fly   200 LTVKSGTPLTMEINLDEDSAPVYGLGVN----------YLDVTDTHTSSETLIFKGCTVDPYLFE 254

  Fly   424 RFRGSWSDSGVYETQVYAYMKTFRFTGSPALYIECDVRMCHGRCPSQPCHWRNLKAVTKRDTSNM 488
            .|.....|.      :.|..|.|:|..|..:.....|.:|..:|....|. .|.....:|.....
  Fly   255 NFNTIDGDI------LSAKFKAFKFPDSSYVQFRATVNVCLDKCLGTQCS-NNQVGFGRRKREIS 312

  Fly   489 TATNISIPPLS-----ADGEGLTTESPTANSLSENVNLFQSLRVL----QEGETDGDDVYAHRQT 544
            :|..:....|:     .|.||:        :.:|.:.|.:.||.|    |....:....:|..||
  Fly   313 SANKVYEISLAMFLQVQDIEGV--------NKNEVLQLEEKLRELKLANQRLARNSRGNFAMEQT 369

  Fly   545 KPLSPHQTCLKTSTFSALTAGCSAVLCVLTVTLF 578
            ...:.....:.......|:||..|....|::.|:
  Fly   370 PASAQPAFVVDERELGHLSAGSGAASNGLSLALW 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15020NP_647901.1 ZP 223..473 CDD:214579 65/296 (22%)
Zona_pellucida <371..472 CDD:278526 25/110 (23%)
qsmNP_001286637.1 ZP 30..298 CDD:214579 66/300 (22%)
Zona_pellucida <200..300 CDD:278526 26/116 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473255
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.