DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15020 and m

DIOPT Version :9

Sequence 1:NP_647901.1 Gene:CG15020 / 38544 FlyBaseID:FBgn0035543 Length:604 Species:Drosophila melanogaster
Sequence 2:NP_572747.1 Gene:m / 44835 FlyBaseID:FBgn0002577 Length:682 Species:Drosophila melanogaster


Alignment Length:391 Identity:105/391 - (26%)
Similarity:173/391 - (44%) Gaps:67/391 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 EYWDQEYAGHQHQHNG-TRVQHIEAECQDDYMKIRIGFNGSFSGLLYSAGYAYDPDCMYINGS-G 261
            |.|..|      :.:| ..:..:|..|..|:|.:.:.|:..|.|::.|.|...||.|:|:..| |
  Fly    35 ELWPME------RPDGMPNIVSLEVMCGKDHMDVHLTFSHPFEGIVSSKGQHSDPRCVYVPPSTG 93

  Fly   262 RDYYEFYIQLNRCGTLGKNSLQEESRKNPTNFMWNTVTVQYNPLIEEEYDEHFKVTCEYGYDFWK 326
            :.::.|.|..:||||  |..|..:       |..|||.|||:..:.|.:||..::.||:..|:.|
  Fly    94 KTFFSFRISYSRCGT--KPDLNGQ-------FYENTVVVQYDKDLLEVWDEAKRLRCEWFNDYEK 149

  Fly   327 TVTFP---FLDVEVA----TGNPVVFTLSPPECYMEIQNGYGIGGPRVTGPVRVGDPLTLIIYMR 384
            |.:.|   ..|::|.    .|:.|       :|:||||:|.|...|.|:|.|.:|..|||::.:.
  Fly   150 TASKPPMVIADLDVIQLDFRGDNV-------DCWMEIQHGKGPWAPPVSGIVPLGSTLTLVVAIN 207

  Fly   385 SKYDGFDIVVNDCYAHNGANKRIQLIDQHGCPVDDKLISRFRGSWSDSGVYETQVYAYMKTFRFT 449
            .....||:.|..|.|.:|:...|.|.|:.||.:..|:||||..:.:.........||:...|:|.
  Fly   208 DYRGEFDMRVKSCVASDGSGHVINLSDEFGCVLRPKMISRFLKARAPDERATVITYAFFHAFKFP 272

  Fly   450 GSPALYIECDVRMCHGRCPSQPCHWRN----------------------LKAVTKRD-------- 484
            .:.:::|:|.|.:|...|..   |.:|                      ..|..::|        
  Fly   273 DALSVHIKCKVEICRHGCLD---HCQNTGVGGGGGGSGESLGLGLGLGLTNANERKDVHMSDALG 334

  Fly   485 -TSNMTATNISIPPLSADGEGLTTESPTANSLSENVNLFQSLRVLQEGETDGDDVYAHRQTKPLS 548
             :||....::::||....|.|:.. .|..:...|:: :....:.|..|.......|.|.::..|.
  Fly   335 SSSNDLLRDLALPPGGQHGMGMGM-GPDHDIFYEDI-IHDHKQTLGGGGMPAGGDYGHEKSVNLQ 397

  Fly   549 P 549
            |
  Fly   398 P 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15020NP_647901.1 ZP 223..473 CDD:214579 82/257 (32%)
Zona_pellucida <371..472 CDD:278526 30/100 (30%)
mNP_572747.1 ZP 55..286 CDD:214579 80/246 (33%)
Zona_pellucida <194..287 CDD:278526 28/92 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473239
Domainoid 1 1.000 82 1.000 Domainoid score I5383
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 78 1.000 Inparanoid score I3815
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14807
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR46560
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.