DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15020 and dyl

DIOPT Version :9

Sequence 1:NP_647901.1 Gene:CG15020 / 38544 FlyBaseID:FBgn0035543 Length:604 Species:Drosophila melanogaster
Sequence 2:NP_647890.2 Gene:dyl / 38531 FlyBaseID:FBgn0066365 Length:611 Species:Drosophila melanogaster


Alignment Length:367 Identity:99/367 - (26%)
Similarity:179/367 - (48%) Gaps:40/367 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 HEVPDHVPDSSGYIPHRIGHPVHLDYGPTGVDSSGAPTG---SGGYHAVPYENSKWQEEYWDQEY 205
            |....|:..::..:.||.|      |||. ....|||.|   :|..:.|       .||.|..  
  Fly    27 HGDASHIESAALPLEHRAG------YGPP-APIYGAPQGPLSTGATNDV-------SEEAWPL-- 75

  Fly   206 AGHQHQHNGTRVQHIEAECQDDYMKIRIGFNGSFSGLLYSAGYAYDPDCMYIN-GSGRDYYEFYI 269
               ...::..:::|::.:|:..:|::.|.|:..|.|:::|.|:..||.|:::. |:|.....|.|
  Fly    76 ---ASTNDSPQIKHLQVQCEKTHMRVNIEFDRPFYGMIFSKGFYSDPHCVHLKPGTGHLSATFEI 137

  Fly   270 QLNRCGTLGKNSLQEESRKNPT---NFMWNTVTVQYNPLIEEEYDEHFKVTCEYGYDFW-KTVTF 330
            .||.||.....:........||   :::.||:.:||:|.::|.:|:..|:.|.: |||: |.|||
  Fly   138 FLNSCGMTSSANHNAAGYGAPTPSGSYVENTIIIQYDPYVQEVWDQARKLRCTW-YDFYEKAVTF 201

  Fly   331 PFLDVEVATGNPVVFTLSPPECYMEIQNGYGIGGPRVTGPVRVGDPLTLIIYMRSKYDGFDIVVN 395
            ....|::.......|.....:|:|:||.|.|.....|:|.|::|..:|:::.::...:.||::|.
  Fly   202 RPFQVDMLHAVTANFLGDNLQCWMQIQVGKGPWASEVSGIVKIGQTMTMVLAIKDDENKFDMLVR 266

  Fly   396 DCYAHNGANKRIQLIDQHGCPVDDKLISRFRGSWSDSGVYETQVYAYMKTFRFTGSPALYIECDV 460
            :|.||:|....|||:||:||.|..|::|:|:...:.........:||.:.|:|..|..::.:|.:
  Fly   267 NCVAHDGKRAPIQLVDQNGCVVRPKIMSKFQKIKNFGPSASVVSFAYFQAFKFPDSMNVHFQCVI 331

  Fly   461 RMCHGRCPSQPCHWRNLKAVTKRDTSNMTATNISIPPLSADG 502
            ::|...||...|            ...:......:|.:.|:|
  Fly   332 QVCRYNCPEPKC------------GPGLPGGEYGLPQIGANG 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15020NP_647901.1 ZP 223..473 CDD:214579 77/254 (30%)
Zona_pellucida <371..472 CDD:278526 30/100 (30%)
dylNP_647890.2 ZP 90..345 CDD:214579 78/267 (29%)
PHA03378 <339..494 CDD:223065 5/35 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473238
Domainoid 1 1.000 82 1.000 Domainoid score I5383
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 78 1.000 Inparanoid score I3815
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14807
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR46560
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.