DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15020 and cutl-8

DIOPT Version :9

Sequence 1:NP_647901.1 Gene:CG15020 / 38544 FlyBaseID:FBgn0035543 Length:604 Species:Drosophila melanogaster
Sequence 2:NP_001250721.1 Gene:cutl-8 / 3565740 WormBaseID:WBGene00013960 Length:625 Species:Caenorhabditis elegans


Alignment Length:361 Identity:85/361 - (23%)
Similarity:132/361 - (36%) Gaps:98/361 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   221 EAECQDDYMKIRIGFNGSFSGLLYSAGYAYDPDCMYINGSGRDYY---EFYIQLNRCGTLGKNSL 282
            :.||.:|.::|.:.....|:|.:|:.|.|...|| |.:..|....   .|.:|...||.....|:
 Worm    31 DIECLEDEIRIWVKTRKIFAGRIYAKGRAELEDC-YKDDFGNQKTRKPHFDLQFGACGMKSLRSV 94

  Fly   283 QEESRKNPTNFMWN-TVTVQYNPLIEEEYDEHFKVTC-----------EYGYDFWKTVTFPFLDV 335
                  :|....:. ||.|.::||...:.|:.:.|.|           |.|...     .|..::
 Worm    95 ------DPRGMYYGITVVVSFHPLFITKVDQAYHVKCFFEEANKGLTAELGVSM-----IPTTEL 148

  Fly   336 EVATGNPVVFTLSPPECYMEIQNGY--GIGGPRVTGPV----RVGDPLTLIIYMRSKYDGFDIVV 394
            |...|        .|.|...|....  .:...|..|.|    |||:.:....:...:..|  :::
 Worm   149 EARHG--------IPGCTYSIHRSTIDELDAGRPAGNVIQFARVGERVLHQWHCNDQMYG--VLI 203

  Fly   395 NDCYAHNGANKRIQLIDQHGCPVDDKLISRFRGSWSDSGVYETQVYAYMKTFRFTGSPALYIECD 459
            |:||..:|..|:..:||..|||:|..||:..|.| ||.    .:.||....|:|...|.::..|.
 Worm   204 NNCYVTDGFGKKADVIDDKGCPIDPILITGIRYS-SDL----QRAYAESSVFKFADKPGVWFFCQ 263

  Fly   460 VRMC---HGRCPSQPCHWRNLKAVTKRDTSNMTATNISIPPLSADGEGLTTESPTANSLSENVNL 521
            |:||   ||.|                                   :|:|  .|:..|:|     
 Worm   264 VQMCMKKHGMC-----------------------------------DGIT--PPSCGSMS----- 286

  Fly   522 FQSLRVLQEGETDGDDVYAHRQTKPLSPHQTCLKTS 557
                ||:..|..|... :...:..|.|..:|..|.|
 Worm   287 ----RVISVGGEDNGG-FEEEEKAPSSRRKTTPKPS 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15020NP_647901.1 ZP 223..473 CDD:214579 71/273 (26%)
Zona_pellucida <371..472 CDD:278526 34/107 (32%)
cutl-8NP_001250721.1 ZP 33..285 CDD:214579 74/315 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 78 1.000 Inparanoid score I3815
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14807
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R17080
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.990

Return to query results.
Submit another query.