DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15020 and cyr

DIOPT Version :9

Sequence 1:NP_647901.1 Gene:CG15020 / 38544 FlyBaseID:FBgn0035543 Length:604 Species:Drosophila melanogaster
Sequence 2:NP_001285004.1 Gene:cyr / 31733 FlyBaseID:FBgn0030001 Length:513 Species:Drosophila melanogaster


Alignment Length:420 Identity:82/420 - (19%)
Similarity:155/420 - (36%) Gaps:93/420 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   216 RVQHIEAECQDDYMKIRIGFNGSFSGLLYSAGYAYDPDCMYINGSGRDYYEFYIQL--NRCGTLG 278
            ::|.::..|..:.:::.:..:..|.||||:..:..  :|   ...|:|....::::  :.||...
  Fly    67 QIQAMQVNCSRELLEMHLELSRPFRGLLYAKDFPL--EC---RARGKDSTRLHLRIPTSGCGVRA 126

  Fly   279 ------------KNSLQEESRKNPTNFMWNTVTVQYN--------PLIEEE--YDEHFKVTCEYG 321
                        :..||:|.:...:..:.::|..|..        |::.:|  :|.:.::..   
  Fly   127 EPLEDGSLEYTVRVMLQKEQKLRQSTDILSSVRCQLPANAMGMPLPVLRQEKGHDRNARMRA--- 188

  Fly   322 YDFWKTVTFPFLDVEVATGNPVVFTLS--------PPECYMEIQNGYGIGGPRVTGPVRVGDPLT 378
                         :..|...|.:...|        .|...:.::    :|||..||.|.||...|
  Fly   189 -------------LAAAAAVPALGATSSINQQQRETPRVRIWLE----LGGPNGTGSVEVGVATT 236

  Fly   379 LIIYMRSKYDG-FDIVVNDCYAHNGANKRI-QLIDQHGCPVDDKLISRF-------RGSWS---D 431
            |.:  |:...| ..:.|.||.|.:|..:.. ||:|..|||:|::::...       ...||   :
  Fly   237 LTV--RAIVPGNIGVRVVDCAALDGLGESTQQLLDARGCPIDEQVMPALHTQHRPAEEGWSKQHE 299

  Fly   432 SGVYETQVYAYMKTFRFTGSPALYIECDVRMCHGRCPSQPCHWRNLKAVTKRDTSNMTATNISIP 496
            ..:.|....|....|:|.....|::.|.|::|.|:||:..|                   .:..|
  Fly   300 EDLVERTFAATFPAFKFPDRERLHVSCGVQLCKGKCPTLNC-------------------RLKTP 345

  Fly   497 PLSADGEGLTTESPTANSLSENVNLFQ--SLRVLQEGETDGDDVYAHRQTKPLSPHQT-CLKTST 558
            |.:...|.........|||:......:  .||..:.....|:|...|.:.:.:....| ||..|.
  Fly   346 PPALSAEQHLARIEVFNSLAVTAPQIEVDRLRYDRRHNMSGEDYAPHVRGQVMPGEGTLCLSISK 410

  Fly   559 FSALTAGCSAVLCVLTVTLFIACSRLKRRK 588
            .:........:..|..|....:..|.:||:
  Fly   411 LAISFCVLGLIFLVAVVVAIFSLIRSRRRE 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15020NP_647901.1 ZP 223..473 CDD:214579 60/293 (20%)
Zona_pellucida <371..472 CDD:278526 32/112 (29%)
cyrNP_001285004.1 ZP 82..344 CDD:214579 60/307 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473267
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR46560
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.