DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15020 and cutl-20

DIOPT Version :9

Sequence 1:NP_647901.1 Gene:CG15020 / 38544 FlyBaseID:FBgn0035543 Length:604 Species:Drosophila melanogaster
Sequence 2:NP_490798.1 Gene:cutl-20 / 171678 WormBaseID:WBGene00018787 Length:360 Species:Caenorhabditis elegans


Alignment Length:356 Identity:81/356 - (22%)
Similarity:142/356 - (39%) Gaps:71/356 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   224 CQDDYMKIRIGFNGSFSGLLYS-AGYAYDPDCMYINGS--GRDYYEFYIQLNRCGTL--GKNSLQ 283
            |......::|.|:.:|.|.:.| ||:   |.|:|.||:  ....|:..|.|..|.|.  |:.:|:
 Worm    30 CDKTDFLLKIKFDENFRGTIQSRAGH---PKCIYANGTLQSDTKYQLKIPLTGCSTKENGEGNLE 91

  Fly   284 EESRKNPTNFMWNTVTVQYNPLIEEEYDEHFKVTCEYGYDFWK--TVTFPFLDVEVATGNPVVFT 346
            .|..           .|..|.....|.|:.|.:||.......|  .||..|..:.:.:......:
 Worm    92 NEIE-----------VVMANNEFNAETDKRFLLTCIPAAPVPKESQVTVSFGGITINSDATTASS 145

  Fly   347 LSPPECY---MEIQNGYGIGGPRVTGPVRVGDPLTLIIYMRSKYDGFDIVVNDCYAHNGANKRIQ 408
            ||..:..   :.:.:|..:...::..|:.|||.:|..:.|....:|   .:..|:|::|.:: :.
 Worm   146 LSDNKTVDYRVRVLDGDSLDSKQLQRPLAVGDRVTYTVEMSDDQNG---RIGRCWANDGISE-LP 206

  Fly   409 LIDQHGCPVDDKLISRFRGS-WSDSGVY----ETQVYAYMKTFRFTGSPALYIECDVRMCHGRCP 468
            |.|.|||.:...      |. |.|..|.    :|..|.::|.:.|..|..:.|.|::.:| ..|.
 Worm   207 LSDSHGCSLQTS------GEVWGDFEVTRRNGKTIFYNHIKAWAFPTSNEVNIFCNLHVC-VTCT 264

  Fly   469 SQPCHWRNLK---------AVTKRDTSNMTATNISIPPL------------------SADGEGLT 506
            ...|..|..:         .|:...:|.:..::|| ||:                  |.....::
 Worm   265 QAACRGRERRHNPPPQHSSTVSDPFSSTIDVSDIS-PPIAVRTSFRLKREAVARLETSQTTSSVS 328

  Fly   507 TESPT---ANSLSENVNLFQSLRVLQEGETD 534
            |:|.|   ::|.|.|::....|.::..|..|
 Worm   329 TDSSTNSSSSSSSANLSFLFFLLIVASGVFD 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15020NP_647901.1 ZP 223..473 CDD:214579 63/263 (24%)
Zona_pellucida <371..472 CDD:278526 27/105 (26%)
cutl-20NP_490798.1 Zona_pellucida 30..268 CDD:365872 63/262 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14780
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46560
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.