DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DOR and tp53inp1

DIOPT Version :9

Sequence 1:NP_001246624.1 Gene:DOR / 38543 FlyBaseID:FBgn0035542 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_001073505.1 Gene:tp53inp1 / 568021 ZFINID:ZDB-GENE-031018-3 Length:241 Species:Danio rerio


Alignment Length:199 Identity:68/199 - (34%)
Similarity:95/199 - (47%) Gaps:44/199 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 ISTLSPPRSVPALGAGDHDTLTQSLYVASPSGSDQGQDHGQGANVLMEESWYVTPPPCFTSIG-- 267
            ::.|.||....:..:.|.        ||.....|....|.: |...:||||::||||||.:.|  
Zfish    60 VAPLDPPVRCSSCSSLDS--------VADTDAEDGNFLHLE-ATCGLEESWFITPPPCFMAGGRA 115

  Fly   268 PINMETSPFENLLIEHPSMSVY--HSIRSTQEGTDSFVNLDLGVSTEVPQQREEPEPEAEPQDQR 330
            |:.:||||.|||||||||||||  ||                      |:||...:...||...|
Zfish   116 PVLLETSPLENLLIEHPSMSVYAVHS----------------------PRQRPAKDSTREPSILR 158

  Fly   331 QALQEQQRAPN-----ARFDSHAAVQLKQQTLARQSQKSKNKKEHQQLCRSAIKRANKVRD---F 387
            ..:|.:...|:     |...:||.. |:|....|.:|:.::..:.|||.|:|::|.|.:||   .
Zfish   159 SEVQRRPSHPSGCYAAALVAAHAGF-LEQTKNGRLAQRIRDNVDRQQLSRNALRRLNLLRDGGAR 222

  Fly   388 QAKA 391
            ||||
Zfish   223 QAKA 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DORNP_001246624.1 DOR 111..406 CDD:291505 68/199 (34%)
tp53inp1NP_001073505.1 DOR 28..232 CDD:291505 68/199 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28KZ8
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008768
OrthoInspector 1 1.000 - - oto38754
orthoMCL 1 0.900 - - OOG6_111649
Panther 1 1.100 - - LDO PTHR31671
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.810

Return to query results.
Submit another query.