DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DOR and tp53inp2

DIOPT Version :9

Sequence 1:NP_001246624.1 Gene:DOR / 38543 FlyBaseID:FBgn0035542 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_001313409.1 Gene:tp53inp2 / 564072 ZFINID:ZDB-GENE-120420-1 Length:158 Species:Danio rerio


Alignment Length:134 Identity:27/134 - (20%)
Similarity:44/134 - (32%) Gaps:29/134 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 QQRTN-----QQQRKQQPAITKLLTPSGEIVDEDFDEDEWYIVEKEDEEDDSLPR---------S 134
            |:.||     ..:..|:|.:.|..:|       :.||:.|.:|...|.|......         |
Zfish     3 QRLTNLLFGSVNETTQEPTVPKPASP-------EVDEEGWLLVNAADGESSETGELQFKLIGSLS 60

  Fly   135 DSE-------EELSVVEVSQPRGGSNNASSPMVTVATGTAFNCRRRQGVNSCSLYSGPRPQQQRN 192
            ::|       .|.|:.|...|...|:...|..:....|......:...:......:. |....||
Zfish    61 NTEICAASLVSEASIAEPEVPVARSSGRVSQRLVSQAGALVKVTQMGRIQRAQARAN-RHSLGRN 124

  Fly   193 YLQR 196
            .:||
Zfish   125 CIQR 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DORNP_001246624.1 DOR 111..406 CDD:291505 20/102 (20%)
tp53inp2NP_001313409.1 DOR <66..147 CDD:291505 12/64 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR31671
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.