DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DOR and si:ch211-260e23.9

DIOPT Version :9

Sequence 1:NP_001246624.1 Gene:DOR / 38543 FlyBaseID:FBgn0035542 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_001373653.1 Gene:si:ch211-260e23.9 / 555795 ZFINID:ZDB-GENE-141222-48 Length:164 Species:Danio rerio


Alignment Length:171 Identity:48/171 - (28%)
Similarity:68/171 - (39%) Gaps:41/171 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 LGAGDHDTLTQSLYVASPSGSDQGQDHGQGANVLM--EESWYVTPPPCFTSIGPINMETSPFENL 279
            :|..|.||             |...|....||:|.  :..|.:.......|:|  :.:|:..|||
Zfish    10 VGRQDKDT-------------DVTDDTHNCANLLEFDDGEWVIIKIDEDQSLG--SSDTNILENL 59

  Fly   280 LIEHPSMSVYHSIRSTQEGTDSFVNLDLGVSTEVPQQREEPEPEAEPQDQRQALQEQQRAPNARF 344
            |||||||||| .:|..|.        ||.       ..||.|..|.|...|:.:..:..|..:  
Zfish    60 LIEHPSMSVY-QMRPDQG--------DLA-------SDEETEDVARPVPVRRHVSWRLAAWGS-- 106

  Fly   345 DSHAAVQLKQQTLARQSQKSKNKKEHQQLCRSAIKRANKVR 385
                  .|...|:....|:::...||::|.|.|:.|.|..|
Zfish   107 ------PLPCSTILLSVQRARVYNEHRKLTRGALNRQNLAR 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DORNP_001246624.1 DOR 111..406 CDD:291505 48/171 (28%)
si:ch211-260e23.9NP_001373653.1 DOR <53..141 CDD:405521 35/111 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR31671
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.