DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DOR and tp53inp1

DIOPT Version :9

Sequence 1:NP_001246624.1 Gene:DOR / 38543 FlyBaseID:FBgn0035542 Length:417 Species:Drosophila melanogaster
Sequence 2:XP_002931577.2 Gene:tp53inp1 / 100490057 XenbaseID:XB-GENE-959922 Length:237 Species:Xenopus tropicalis


Alignment Length:173 Identity:49/173 - (28%)
Similarity:70/173 - (40%) Gaps:55/173 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   251 MEESWYVTPPPCFTS--IGPINMETSPFENLLIEHPSMSVYHSIRSTQEGTDSFVNLDLGVSTEV 313
            |||||:||||||||:  :..:.::|||.|||||||||||||                      .|
 Frog    91 MEESWFVTPPPCFTAGELTSMAVKTSPMENLLIEHPSMSVY----------------------AV 133

  Fly   314 PQQREEPEPEAE---PQDQRQALQEQQRAPNARFDSHAAVQLKQQTLARQSQKSKNKK------- 368
            .....:||...|   |...|..|..:.:......  |.::    ..||.:.:..:|.|       
 Frog   134 HNMCHKPETSCESGFPSPDRTELATENKKKGKHI--HCSI----AALAARIKGLENTKIYLGDKL 192

  Fly   369 ------EHQQLCRSAIKRANKVRDFQAKANRPRRSEMQHCKLV 405
                  :|..  |...:|.|.:|..       |..:.:|.:|:
 Frog   193 TKLHLEKHPS--RKGFRRQNLIRGC-------RSQQTKHSRLL 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DORNP_001246624.1 DOR 111..406 CDD:291505 49/173 (28%)
tp53inp1XP_002931577.2 DOR 24..228 CDD:405521 49/173 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008768
OrthoInspector 1 1.000 - - otm47711
Panther 1 1.100 - - LDO PTHR31671
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.