DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15019 and llphp3

DIOPT Version :9

Sequence 1:NP_001097502.1 Gene:CG15019 / 38542 FlyBaseID:FBgn0035541 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_001001225.1 Gene:llphp3 / 407903 XenbaseID:XB-GENE-959007 Length:123 Species:Xenopus tropicalis


Alignment Length:142 Identity:46/142 - (32%)
Similarity:70/142 - (49%) Gaps:22/142 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGRNNRSRKRRDEMNKIKKARYEAKELIRLKKTLGLLDADGNEIMKDISDVVEIKTAKELKREAK 65
            |.::.||:.:| :|...|:.:...|||.|||..|    |.|:|::.|  ||.||.|....|   |
 Frog     1 MAKSIRSKWKR-KMRAEKRKKNAPKELARLKNVL----AKGSEVLMD--DVKEIATVVPSK---K 55

  Fly    66 SKEEQELIYEHQESLEKGEKVKVTNENTGVEHIFNSKTLKDQYGNYPAWF---KKKKTAKRLRKK 127
            ..|:.::..:..|    |:..|:     .:|...|.|.|:||:|.||.|.   ::||...:..||
 Frog    56 INEKTDMDVDAPE----GDSSKM-----DMELKRNKKNLRDQHGQYPVWLNQRQQKKLKSQCGKK 111

  Fly   128 QHSQKKNFKQAW 139
            :...|:..|.||
 Frog   112 KGKSKQAKKLAW 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15019NP_001097502.1 Laps 3..135 CDD:287178 42/134 (31%)
llphp3NP_001001225.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23 6/22 (27%)
Laps 3..109 CDD:401977 39/124 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 55..123 21/76 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1594400at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR34253
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.