DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx17 and STX16

DIOPT Version :9

Sequence 1:NP_001261414.1 Gene:Syx17 / 38541 FlyBaseID:FBgn0035540 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_001001433.1 Gene:STX16 / 8675 HGNCID:11431 Length:325 Species:Homo sapiens


Alignment Length:177 Identity:40/177 - (22%)
Similarity:65/177 - (36%) Gaps:54/177 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 REKVREEDLERFDD----LMKPGRDTAFAGMKEFAELQLKSPTSTLSSQYDDDLDNQPQEVDMNS 135
            |.|.|||..:.|.|    ||..|.|.... .:.|.|.||..                   |:.|:
Human   186 RMKNREERSQHFFDTSVPLMDDGDDNTLY-HRGFTEDQLVL-------------------VEQNT 230

  Fly   136 LPAHRHMPQLQLNFQLEEHQLAQRQACLDQMENLQQEIYDLHGMFQGMRQLTAEQSVAVEKIADN 200
            |             .:||.:...||        :.|.|.||:.:|:.:..:..||...:::|..|
Human   231 L-------------MVEEREREIRQ--------IVQSISDLNEIFRDLGAMIVEQGTVLDRIDYN 274

  Fly   201 AEEALENVQQGELNLRRALTYKK---------AMYPVVGALLGTCVG 238
            .|::....:.|...|.:|..|:|         .::.::..|:...||
Human   275 VEQSCIKTEDGLKQLHKAEQYQKKNRKMLVILILFVIIIVLIVVLVG 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx17NP_001261414.1 SNARE_syntaxin17 156..217 CDD:277199 14/60 (23%)
STX16NP_001001433.1 COG5325 75..301 CDD:227635 37/155 (24%)
SNARE_syntaxin16 233..291 CDD:277198 16/65 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.