DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx17 and PEP12

DIOPT Version :9

Sequence 1:NP_001261414.1 Gene:Syx17 / 38541 FlyBaseID:FBgn0035540 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_014679.1 Gene:PEP12 / 854201 SGDID:S000005562 Length:288 Species:Saccharomyces cerevisiae


Alignment Length:244 Identity:53/244 - (21%)
Similarity:109/244 - (44%) Gaps:39/244 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LKQAEVSIQRFQDVAVPHHLSLLKNHRSNIEKSLALGDWQKIKKEELNAMRV---------IKQI 64
            ||: ||:.:.|:   :...:|.|:...:.::..:..||......|.:|...|         ||::
Yeast    29 LKE-EVAAELFE---INGQISTLQQFTATLKSFIDRGDVSAKVVERINKRSVAKIEEIGGLIKKV 89

  Fly    65 KNLLLEMDALREKVREEDLERFDDLM--KPGRDTAFAGMKEFAELQL-----------KSPTSTL 116
            ...:.:|||    :.|..|::...:.  |..||.::: .:||..:|.           ::..|..
Yeast    90 NTSVKKMDA----IEEASLDKTQIIAREKLVRDVSYS-FQEFQGIQRQFTQVMKQVNERAKESLE 149

  Fly   117 SSQYDDDLDNQPQEVDMNSLPAHRHMPQLQLNFQ---LEEHQLAQRQACLDQ----MENLQQEIY 174
            :|:..:|.....:|...||..:.| :|..|:..:   :...:.|.:|..::|    :.|:::.|.
Yeast   150 ASEMANDAALLDEEQRQNSSKSTR-IPGSQIVIERDPINNEEFAYQQNLIEQRDQEISNIERGIT 213

  Fly   175 DLHGMFQGMRQLTAEQSVAVEKIADNAEEALENVQQGELNLRRALTYKK 223
            :|:.:|:.:..:..:|.|.|:.|..|.....:|.|.....||:|:.|:|
Yeast   214 ELNEVFKDLGSVVQQQGVLVDNIEANIYTTSDNTQLASDELRKAMRYQK 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx17NP_001261414.1 SNARE_syntaxin17 156..217 CDD:277199 15/64 (23%)
PEP12NP_014679.1 COG5325 4..288 CDD:227635 53/244 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19957
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.