DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx17 and ATSYP24

DIOPT Version :9

Sequence 1:NP_001261414.1 Gene:Syx17 / 38541 FlyBaseID:FBgn0035540 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_174506.1 Gene:ATSYP24 / 840119 AraportID:AT1G32270 Length:416 Species:Arabidopsis thaliana


Alignment Length:272 Identity:51/272 - (18%)
Similarity:107/272 - (39%) Gaps:60/272 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 NHRSNIEKSLALGDWQKIKKEELNAMRVIKQIKNLLLEMDALREKVREEDLERFDDLMKPGRDTA 97
            :||.::.:|..:.| .|:.|:...|::..::.:::.:|                       |:|:
plant   178 DHRRDVAQSKKIAD-AKLAKDFEAALKEFQKAQHITVE-----------------------RETS 218

  Fly    98 FAGMKEFAELQLKSPTSTLSSQYDDDLD-NQPQEVDMNSLPAHRHMPQLQLNFQLEEHQLAQRQA 161
            :        :......|..||:.|...| :|.|.|.|.|  ..:.:..|.....|.|.::..|:.
plant   219 Y--------IPFDPKGSFSSSEVDIGYDRSQEQRVLMES--RRQEIVLLDNEISLNEARIEAREQ 273

  Fly   162 CLDQMENLQQEIYDLHGMFQGMRQLTAEQSVAVEKIADNAEEALENVQ----QGELNLRRALTYK 222
            .:.::::...|:.:   ||:.:..:...|..     .|:.:|.::|::    ||:.:|.:|...:
plant   274 GIQEVKHQISEVME---MFKDLAVMVDHQGT-----IDDIDEKIDNLRSAAAQGKSHLVKASNTQ 330

  Fly   223 KAMYPVVGALLGTCVGGPIGLVAGMKAGGLAAVGCGILGFTGGSVLKANPNVMHGNIEEEQVEPD 287
            .:.    .:||.:|    ..|:....:|.|....|     .|....:.||.......|||..|..
plant   331 GSN----SSLLFSC----SLLLFFFLSGDLCRCVC-----VGSENPRLNPTRRKAWCEEEDEEQR 382

  Fly   288 SESTERLELKEK 299
            .:..::..:.||
plant   383 KKQQKKKTMSEK 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx17NP_001261414.1 SNARE_syntaxin17 156..217 CDD:277199 11/64 (17%)
ATSYP24NP_174506.1 LEA_2 35..137 CDD:281199
Syntaxin_2 <154..219 CDD:291208 10/64 (16%)
SNARE_Qa 268..325 CDD:277193 11/64 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19957
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.