DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx17 and ATSYP24

DIOPT Version :10

Sequence 1:NP_001261414.1 Gene:Syx17 / 38541 FlyBaseID:FBgn0035540 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_174506.1 Gene:ATSYP24 / 840119 AraportID:AT1G32270 Length:416 Species:Arabidopsis thaliana


Alignment Length:272 Identity:51/272 - (18%)
Similarity:107/272 - (39%) Gaps:60/272 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 NHRSNIEKSLALGDWQKIKKEELNAMRVIKQIKNLLLEMDALREKVREEDLERFDDLMKPGRDTA 97
            :||.::.:|..:.| .|:.|:...|::..::.:::.:|                       |:|:
plant   178 DHRRDVAQSKKIAD-AKLAKDFEAALKEFQKAQHITVE-----------------------RETS 218

  Fly    98 FAGMKEFAELQLKSPTSTLSSQYDDDLD-NQPQEVDMNSLPAHRHMPQLQLNFQLEEHQLAQRQA 161
            :        :......|..||:.|...| :|.|.|.|.|  ..:.:..|.....|.|.::..|:.
plant   219 Y--------IPFDPKGSFSSSEVDIGYDRSQEQRVLMES--RRQEIVLLDNEISLNEARIEAREQ 273

  Fly   162 CLDQMENLQQEIYDLHGMFQGMRQLTAEQSVAVEKIADNAEEALENVQ----QGELNLRRALTYK 222
            .:.::::...|:.:   ||:.:..:...|..     .|:.:|.::|::    ||:.:|.:|...:
plant   274 GIQEVKHQISEVME---MFKDLAVMVDHQGT-----IDDIDEKIDNLRSAAAQGKSHLVKASNTQ 330

  Fly   223 KAMYPVVGALLGTCVGGPIGLVAGMKAGGLAAVGCGILGFTGGSVLKANPNVMHGNIEEEQVEPD 287
            .:.    .:||.:|    ..|:....:|.|....|     .|....:.||.......|||..|..
plant   331 GSN----SSLLFSC----SLLLFFFLSGDLCRCVC-----VGSENPRLNPTRRKAWCEEEDEEQR 382

  Fly   288 SESTERLELKEK 299
            .:..::..:.||
plant   383 KKQQKKKTMSEK 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx17NP_001261414.1 SNARE_syntaxin17 156..217 CDD:277199 11/64 (17%)
ATSYP24NP_174506.1 LEA_2 34..137 CDD:427176
Syntaxin_2 <154..220 CDD:464199 10/73 (14%)
SNARE_Qa 268..325 CDD:277193 11/64 (17%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.