DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx17 and SYP21

DIOPT Version :9

Sequence 1:NP_001261414.1 Gene:Syx17 / 38541 FlyBaseID:FBgn0035540 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_197185.1 Gene:SYP21 / 831546 AraportID:AT5G16830 Length:279 Species:Arabidopsis thaliana


Alignment Length:211 Identity:47/211 - (22%)
Similarity:86/211 - (40%) Gaps:38/211 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 LKNHRSNIEKSLALGDWQKIKKEELNAMRVIKQIKNLLLEMDALREKVREEDLERFDDLMKPGRD 95
            |.|.....:.:|.|.|  |::|..|       ||..|:....|..::..|.||......:|...|
plant    53 LVNSIGTPKDTLELRD--KLQKTRL-------QISELVKNTSAKLKEASEADLHGSASQIKKIAD 108

  Fly    96 TAFAG-----MKEFAELQLKSP----------TSTLSSQYDDDLDNQPQEVDMNSLPAHRHMPQL 145
            ...|.     :|||.:.|..:.          |..:.:.|     |.| |:|..||...:....|
plant   109 AKLAKDFQSVLKEFQKAQRLAAEREITYTPVVTKEIPTSY-----NAP-ELDTESLRISQQQALL 167

  Fly   146 QLNFQLE----EHQLAQRQACLDQME----NLQQEIYDLHGMFQGMRQLTAEQSVAVEKIADNAE 202
            ..:.:.|    ::::...:|.:::.|    .::.:|.|::|||:.:..:...|...|:.|:.|.:
plant   168 LQSRRQEVVFLDNEITFNEAIIEEREQGIREIEDQIRDVNGMFKDLALMVNHQGNIVDDISSNLD 232

  Fly   203 EALENVQQGELNLRRA 218
            .:.....|..:.||:|
plant   233 NSHAATTQATVQLRKA 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx17NP_001261414.1 SNARE_syntaxin17 156..217 CDD:277199 13/64 (20%)
SYP21NP_197185.1 SynN 27..164 CDD:238105 30/125 (24%)
SNARE_Qa 189..247 CDD:277193 12/57 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19957
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.