DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx17 and SYP42

DIOPT Version :9

Sequence 1:NP_001261414.1 Gene:Syx17 / 38541 FlyBaseID:FBgn0035540 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_567223.1 Gene:SYP42 / 827505 AraportID:AT4G02195 Length:323 Species:Arabidopsis thaliana


Alignment Length:212 Identity:47/212 - (22%)
Similarity:87/212 - (41%) Gaps:58/212 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 NHRSNIEKSLALGDWQKIKKEELNAMRVIKQIKNLLLEMDALREKVREEDLERFDDLMKPGRDTA 97
            |.|.|:::|||                  ..::||.:|   ||.| :...|:|... .|.|:|  
plant   150 NLRKNVQRSLA------------------TDLQNLSME---LRRK-QSTYLKRLQQ-QKEGQD-- 189

  Fly    98 FAGMKEFAELQLKSPTSTLSSQYDDDLDNQPQEVDMNSLPAHRHMPQLQLNFQLEE--HQLAQRQ 160
                    |:.|:...:...|:.|       :|.::..:....|.     ..:|:|  |..|:|:
plant   190 --------EVDLEFNVNGKMSRLD-------EEDELGGMGFDEHQ-----TIKLKEGQHVSAERE 234

  Fly   161 ACLDQMENLQQEIYDLHGMFQGMRQLTA---EQSVAVEKIADNAEEALENVQQGELNLRRALTYK 222
                  ..:||.:..::.:.|.|:.|:|   :|...|::|..|.:....:|::|...|::|...:
plant   235 ------REIQQVLGSVNDLAQIMKDLSALVIDQGTIVDRIDYNVQNVSTSVEEGYKQLQKAERTQ 293

  Fly   223 K--AMYPVVGALLGTCV 237
            :  ||......||..|:
plant   294 REGAMVKCATILLVLCL 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx17NP_001261414.1 SNARE_syntaxin17 156..217 CDD:277199 15/63 (24%)
SYP42NP_567223.1 SynN 74..180 CDD:294095 13/51 (25%)
SNARE_syntaxin16 231..288 CDD:277198 15/62 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.